Sequence 1: | NP_001262650.1 | Gene: | MESK4 / 64872 | FlyBaseID: | FBgn0043069 | Length: | 280 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036051.1 | Gene: | Aldh1a7 / 26358 | MGIID: | 1347050 | Length: | 501 | Species: | Mus musculus |
Alignment Length: | 251 | Identity: | 51/251 - (20%) |
---|---|---|---|
Similarity: | 77/251 - (30%) | Gaps: | 89/251 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 SPLNPCLTEVLRNCANIQSLESLNYEYNDVL----------LTED-----------NVGKMITPN 58
Fly 59 PYSFSGNISISSCPSEDVSFSE--------SILEDNGRISLAYENLKTIPRRLADKFAAQTKFLD 115
Fly 116 LSHNDFRNLRFLSFFEDLDTLILDRNVNLDINTFPYLPSLRILWINNCDIANITDWIHRIERHCP 180
Fly 181 AL-------DQLSCMGN---------------------------PGIRTVFGGQGP 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
MESK4 | NP_001262650.1 | leucine-rich repeat | 111..132 | CDD:275378 | 4/20 (20%) |
leucine-rich repeat | 133..154 | CDD:275378 | 5/20 (25%) | ||
leucine-rich repeat | 155..181 | CDD:275378 | 5/25 (20%) | ||
Aldh1a7 | NP_036051.1 | ALDH_F1AB_F2_RALDH1 | 15..494 | CDD:143459 | 47/239 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1012 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |