DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESK4 and ALDH1B1

DIOPT Version :9

Sequence 1:NP_001262650.1 Gene:MESK4 / 64872 FlyBaseID:FBgn0043069 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_000683.3 Gene:ALDH1B1 / 219 HGNCID:407 Length:517 Species:Homo sapiens


Alignment Length:144 Identity:30/144 - (20%)
Similarity:51/144 - (35%) Gaps:28/144 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LNPCLTEVLRNCANIQSLESL-------NYEYNDVLLT---EDNVGKMITPNPYSFSGNI--SIS 69
            |.|.|..:....|...|..:|       :..||.:.:.   :|.|.|...|.....:|.:  .::
Human     5 LAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHVA 69

  Fly    70 SCPSEDVSFSESILEDNGRISLAYENLKTIPR-----RLAD------KFAAQTKFLDLSHNDFRN 123
            .....||..:.....:..|:...:..:....|     ||||      .:.|..:.|| :...|:.
Human    70 EGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVYLASLETLD-NGKPFQE 133

  Fly   124 LRFLSFFEDLDTLI 137
                |:..|||.:|
Human   134 ----SYALDLDEVI 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESK4NP_001262650.1 leucine-rich repeat 111..132 CDD:275378 4/20 (20%)
leucine-rich repeat 133..154 CDD:275378 3/5 (60%)
leucine-rich repeat 155..181 CDD:275378
ALDH1B1NP_000683.3 ALDH_F1AB_F2_RALDH1 31..511 CDD:143459 24/118 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.