DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESK4 and T19D7.6

DIOPT Version :9

Sequence 1:NP_001262650.1 Gene:MESK4 / 64872 FlyBaseID:FBgn0043069 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_508138.2 Gene:T19D7.6 / 188606 WormBaseID:WBGene00020574 Length:156 Species:Caenorhabditis elegans


Alignment Length:114 Identity:37/114 - (32%)
Similarity:59/114 - (51%) Gaps:10/114 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 LDTLILDRNVNLDINTF--PYLPSLRILWINNCDIANITDWIHRIERHCPALDQLSCMGNPGIRT 195
            ::.|.||.|| |..|:|  |...:|:.|.:.|..|.|:...:..|:::||.::.|....||||..
 Worm    48 IEKLTLDNNV-LTENSFNMPKFANLKELSVRNNKIRNLGVLLANIQKNCPNIEVLRVKNNPGIPE 111

  Fly   196 VFGGQGPREYILQVLPQLKYLDGLPTSRNAAYATLSSSQGQGPDSTSNS 244
            .| .:..:..|.:||.:|:.|:||.|.|...|:      |...||.::|
 Worm   112 KF-TEKEKMLISKVLKKLRVLNGLETHRQKRYS------GCSTDSKTSS 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESK4NP_001262650.1 leucine-rich repeat 111..132 CDD:275378
leucine-rich repeat 133..154 CDD:275378 9/22 (41%)
leucine-rich repeat 155..181 CDD:275378 7/25 (28%)
T19D7.6NP_508138.2 leucine-rich repeat 48..70 CDD:275378 9/22 (41%)
leucine-rich repeat 71..97 CDD:275378 7/25 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto20483
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46282
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16981
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
55.000

Return to query results.
Submit another query.