DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL1 and CG33110

DIOPT Version :9

Sequence 1:NP_001243328.1 Gene:ELOVL1 / 64834 HGNCID:14418 Length:279 Species:Homo sapiens
Sequence 2:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster


Alignment Length:299 Identity:122/299 - (40%)
Similarity:173/299 - (57%) Gaps:24/299 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     4 VVNLYQEVMK--HADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYN 66
            :|..|.::::  :.|||.:.:|||..|:....::..|:.:||.:||..|.:|||||||..::|||
  Fly    40 LVQRYYQLVEEDYGDPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRRTLVVYN 104

Human    67 FSLVALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFIELMDTVIFILR 131
            ...||||.|:.||.||:|||:.|..:|.|||||:||.:.||:.:.:|:..||..|..||:.|:||
  Fly   105 AFQVALSGYMFYEHLMAGWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMFFVLR 169

Human   132 KKDGQVTFLHVFHHSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMYLYYGLSAFGPVAQPYLW 196
            ||..|:|:|||:||||.|...|..||...||..:|..::|:.|||.||.||.::|.||....:||
  Fly   170 KKSSQITWLHVYHHSVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYYMMAAMGPEYAKFLW 234

Human   197 WKKHMTAIQLIQFVLVSLHISQYYFMSSCNYQYPVIIHLIWMYGTIFFMLFSNFWYHSYTKGKRL 261
            |||:||.:|:.||||...|..:..|.:.|.:. ..|..|:.:..:|||.||.||:..||.|.|..
  Fly   235 WKKYMTELQIAQFVLCIFHTLRALFSNQCQFS-KFISALLLLNASIFFCLFMNFYMQSYRKTKAA 298

Human   262 PRALQQ---------------------NGAPGIAKVKAN 279
            .:..||                     |.|....|:|||
  Fly   299 QQLQQQQQQQKQQQQLDATPCKADSNNNTAMLAQKLKAN 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVL1NP_001243328.1 ELO 23..260 CDD:307345 108/236 (46%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03201 275..279 2/3 (67%)
CG33110NP_788716.1 ELO 61..294 CDD:279492 107/233 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2831
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.