DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL1 and bond

DIOPT Version :9

Sequence 1:NP_001243328.1 Gene:ELOVL1 / 64834 HGNCID:14418 Length:279 Species:Homo sapiens
Sequence 2:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster


Alignment Length:331 Identity:109/331 - (32%)
Similarity:165/331 - (49%) Gaps:71/331 - (21%)


- Green bases have known domain annotations that are detailed below.


Human     1 MEAVVNLYQE----VMKHADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGF 61
            |...:.:.:|    :.|..|..:..:.||.||:.:.:::|.|:.|||.:||..|.||||..|:..
  Fly     1 MTNYIKIVEERISGLSKGVDETVDSWFLMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRI 65

Human    62 MIVYNFSLVALSLYIVYEFLMSGWL------------STYTWRCDPVDYSNSPEALRMVRVAWLF 114
            |:.||          .::.|.|.|:            |.::.:|: ::.:.. :.|.:...||.:
  Fly    66 MVFYN----------AFQVLYSIWMCRTSIQESNVMASIFSKKCE-INRTRE-QNLTLYSGAWFY 118

Human   115 LFSKFIELMDTVIFILRKKDGQVTFLHVFHHSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMY 179
            .|||.|:|:||..|:|||||.||:||||:||::.....|..:|.|||..|....::||.||:|||
  Fly   119 FFSKIIDLLDTTFFVLRKKDNQVSFLHVYHHTITVLFSWGYLKYAPGEQGVIIGILNSGVHIIMY 183

Human   180 LYYGLSAFGPVAQPYLWWKKHMTAIQLIQFVLVSLHISQYYFMS----SCNYQYPVIIHLIWMYG 240
            .||.::|.||..|.||||||:||:||||||||:     ..|.::    .||  .|..:...::..
  Fly   184 FYYMVAAMGPQYQKYLWWKKYMTSIQLIQFVLI-----LGYMLTVGAKGCN--MPKTLTFFFVGN 241

Human   241 TIFFM-LFSNFWYHSYTKGKR-------------------------LPRA------LQQNGAPGI 273
            |:.|: ||.||:..:|.|.|.                         :|:.      |.|||..|.
  Fly   242 TVIFLYLFGNFYRKTYKKAKSVDGGSRTTGSSLAQSALRAAGGMGCMPQTMNAGKHLLQNGQVGK 306

Human   274 AKVKAN 279
            |.:..|
  Fly   307 AYIDLN 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVL1NP_001243328.1 ELO 23..260 CDD:307345 96/253 (38%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03201 275..279 0/3 (0%)
bondNP_651062.3 ELO 27..262 CDD:279492 96/253 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.