DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL1 and CG5326

DIOPT Version :10

Sequence 1:NP_073732.1 Gene:ELOVL1 / 64834 HGNCID:14418 Length:279 Species:Homo sapiens
Sequence 2:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster


Alignment Length:257 Identity:106/257 - (41%)
Similarity:158/257 - (61%) Gaps:4/257 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     1 MEAVVNLYQEVMKHADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVY 65
            ::.:||.:.|   |.|.|.:.:.|..:|..:..||..|:||.|..|||.|.:||||:|:..::||
  Fly    12 VDRMVNFFVE---HEDLRTKQWFLSNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFELKNTLLVY 73

Human    66 NFSLVALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFIELMDTVIFIL 130
            |...|.||..:.||....||...|.::|.||.|.:.|.::||.|..||:..:|..||:|||.|:|
  Fly    74 NAVQVLLSWVLFYEGYKGGWGGHYNFKCQPVTYESDPISMRMARAVWLYYIAKITELLDTVFFVL 138

Human   131 RKKDGQVTFLHVFHHSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMYLYYGLSAFGPVAQPYL 195
            |||..|::|||::||:::|...:.|||...||.|:....|||.:|:|||.||.|||.||..|.||
  Fly   139 RKKQRQISFLHLYHHTLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGPKVQKYL 203

Human   196 WWKKHMTAIQLIQFVLVSLHISQYYFMSSCNYQYPVIIHLIWMYGTIFFMLFSNFWYHSYTK 257
            ||||::|.:|::||:::.:|..|..|..:||:...:...|.:..| :|..:||.|:..:|.|
  Fly   204 WWKKYITILQIVQFLIIFVHTLQIQFQPNCNFPKSIAALLTFNAG-LFTYMFSAFYVANYKK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVL1NP_073732.1 ELO 23..262 CDD:460083 100/235 (43%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03201 275..279
CG5326NP_651060.1 ELO 30..262 CDD:460083 98/232 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.