DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL1 and Baldspot

DIOPT Version :9

Sequence 1:NP_001243328.1 Gene:ELOVL1 / 64834 HGNCID:14418 Length:279 Species:Homo sapiens
Sequence 2:NP_648909.1 Gene:Baldspot / 39860 FlyBaseID:FBgn0260960 Length:316 Species:Drosophila melanogaster


Alignment Length:294 Identity:78/294 - (26%)
Similarity:130/294 - (44%) Gaps:98/294 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    37 TYVYF-------VLSLGPRIMANRKPFQLRGFMIVYNFSLVALSLYIVYEFLMSGWLSTYTWRCD 94
            |:|::       |:..|...|.||..|||||.:|::| :|:|:       |.:.|...|      
  Fly    36 TWVFYYCGIYMLVIFGGQHFMQNRPRFQLRGPLIIWN-TLLAM-------FSIMGAART------ 86

Human    95 PVDYSNSPEALRMVR----------------------VAWLFLFSKFIELMDTVIFILRKKDGQV 137
                  :||.:.::|                      ..|||:.||..||.||:..:|||:  .:
  Fly    87 ------APELIHVLRHYGLFHSVCVPSYIEQDRVCGFWTWLFVLSKLPELGDTIFIVLRKQ--PL 143

Human   138 TFLHVFHH-SVLPWSWW----------WGVKIAPGGMGSFHAMINSSVHVIMYLYYGLSA--FGP 189
            .|||.:|| :||.:||:          |.:            ::|..||.:||.||.|.|  |.|
  Fly   144 IFLHWYHHITVLIYSWFSYTEYTSSARWFI------------VMNYCVHSVMYSYYALKAARFNP 196

Human   190 VAQPYLWWKKHMTAIQLIQFVL-VSLHISQYYFM-----SSCNYQYPVIIHLIWMYGTIFFMLFS 248
            ..    :....:|::||.|.:: .::::....|:     |||:.....|...|.||.: :|:||:
  Fly   197 PR----FISMIITSLQLAQMIIGCAINVWANGFLKTHGTSSCHISQRNINLSIAMYSS-YFVLFA 256

Human   249 NFWYHSYT-----KGKRLPRAL------QQNGAP 271
            .|:|.:|.     |.:|:..:|      :|:.:|
  Fly   257 RFFYKAYLAPGGHKSRRMAASLAAQNVVKQSSSP 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVL1NP_001243328.1 ELO 23..260 CDD:307345 74/275 (27%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03201 275..279
BaldspotNP_648909.1 ELO 30..271 CDD:395916 73/273 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.