DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL1 and Elo68beta

DIOPT Version :9

Sequence 1:NP_001243328.1 Gene:ELOVL1 / 64834 HGNCID:14418 Length:279 Species:Homo sapiens
Sequence 2:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster


Alignment Length:247 Identity:92/247 - (37%)
Similarity:129/247 - (52%) Gaps:15/247 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    15 ADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLVALSLYIVYE 79
            ||.|.|.:||:.||..:.::|..|:..| ...|:..|..||.|||..:..::.:::.|:.||..|
  Fly    22 ADERTQDWPLVKSPWNIIALLALYLLMV-RYAPKWTARCKPLQLRVPLFCHSLAMIFLNGYICLE 85

Human    80 FLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFIELMDTVIFILRKKDGQVTFLHVFH 144
            ||.:.....|.:.|.....|:.|..:|:....|.|..||.:|.:||..||||.|..|::||||:|
  Fly    86 FLTASLSLGYNFACQECRVSHDPHEIRIAAAMWWFYISKILEFVDTAFFILRHKWNQLSFLHVYH 150

Human   145 HSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMYLYYGLSAFGPVAQPYLWWKKHMTAIQLIQF 209
            ||.:....|..||..|.|...|.:||||.||||||.||.||..||..|.:||||:::|.:||:||
  Fly   151 HSTMFLFCWTYVKWLPTGSTFFPSMINSFVHVIMYSYYALSVLGPRVQRFLWWKRYLTGLQLVQF 215

Human   210 VLVSLHISQYYFMSSCNYQYPVIIHLIWM------YGTIFFMLFSNFWYHSY 255
            .::....||..| ..|.|..       |:      |...|..:|..|:...|
  Fly   216 TIIFFWASQLVF-RGCEYGK-------WLTPIGAAYMVPFLFMFGRFYAQKY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVL1NP_001243328.1 ELO 23..260 CDD:307345 88/239 (37%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03201 275..279
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 82/221 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.