DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL1 and CG18609

DIOPT Version :10

Sequence 1:NP_073732.1 Gene:ELOVL1 / 64834 HGNCID:14418 Length:279 Species:Homo sapiens
Sequence 2:NP_611365.2 Gene:CG18609 / 37158 FlyBaseID:FBgn0034382 Length:263 Species:Drosophila melanogaster


Alignment Length:260 Identity:90/260 - (34%)
Similarity:140/260 - (53%) Gaps:23/260 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    15 ADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYN-FSLVALSLY--- 75
            |||  ...||.|||..:|.||:.|:.|||.||...|.||||:.|:..:.||| |.::...||   
  Fly    10 ADP--NPIPLAGSPWPITLILIAYLLFVLKLGKIFMRNRKPYDLKTVLKVYNLFQVLYNGLYFGM 72

Human    76 IVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFIELMDTVIFILRKKDGQVTFL 140
            :.|...:.|..:.:.....|..:... :..|::..|  :|.:|.::|||||.|:|||...|:|||
  Fly    73 VFYYLFIVGICNLHCIESFPEGHERK-QLERVLHAA--YLLNKVLDLMDTVFFVLRKSYKQITFL 134

Human   141 HVFHHSVLPW-----SWWWGVKIAPGGMGSFHAMINSSVHVIMYLYYGLSAFGPVAQPYLWWKKH 200
            |::||..:.:     :.::|.    ||..:...::||.||.:||.||.||:..|..:..:||||:
  Fly   135 HIYHHVFMSFGSYALTRYYGT----GGHVNAVGLLNSLVHTVMYFYYFLSSEYPGVRANIWWKKY 195

Human   201 MTAIQLIQ-FVLVSLHISQYYFMSSCNYQYPVIIHLIWMYGTIFFMLFSNFWYHSYTKGKRLPRA 264
            :|..||.| |:|:|..|...:|..:|..... :::|..:.|.:|..||..|:..:|.   |.|:|
  Fly   196 ITLTQLCQFFMLLSYAIYVRFFSPNCGVPRG-LLYLNMVQGVVFIYLFGKFYIDNYL---RPPKA 256

Human   265  264
              Fly   257  256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVL1NP_073732.1 ELO 23..262 CDD:460083 85/248 (34%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03201 275..279
CG18609NP_611365.2 ELO 16..257 CDD:460083 87/252 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.