DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL1 and Elo68alpha

DIOPT Version :9

Sequence 1:NP_001243328.1 Gene:ELOVL1 / 64834 HGNCID:14418 Length:279 Species:Homo sapiens
Sequence 2:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster


Alignment Length:245 Identity:87/245 - (35%)
Similarity:128/245 - (52%) Gaps:11/245 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    16 DPRIQGYPLMGS----PLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLVALSLYI 76
            |.|.:.:||:.|    |:|::..||...|     .|:.....||.|||..:..::.::|.|:.||
  Fly    16 DERTRNWPLVDSFWTVPVLLSIYLLMVRY-----APKWTTRHKPLQLRAPLFCHSLAMVFLNGYI 75

Human    77 VYEFLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFIELMDTVIFILRKKDGQVTFLH 141
            ..|...:.....|.:.|.|...|..|..:|:.:..|.|..||.:|..||..||||:|..|::|||
  Fly    76 CLELYAATRDLDYNFGCQPCRVSFDPHEMRLTKAFWWFYISKILEFADTAFFILRQKWSQLSFLH 140

Human   142 VFHHSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMYLYYGLSAFGPVAQPYLWWKKHMTAIQL 206
            |:|||.:....|..:|..|.|.....|||||.||:|||.||.||..||..|.:||||:::|.:||
  Fly   141 VYHHSTMFVFCWILIKWMPTGSTYVPAMINSFVHIIMYGYYALSVLGPRVQRFLWWKRYLTGLQL 205

Human   207 IQFVLVSLHISQYYFMSSCNYQYPVIIHLIWMYGTIFFMLFSNFWYHSYT 256
            :||.::....|| ..:..|.|...:.:.:. :|...|..:|..|:...||
  Fly   206 VQFTIIFFWASQ-MLVRGCEYGTWITLSMA-IYSLPFLFMFGKFYMQKYT 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVL1NP_001243328.1 ELO 23..260 CDD:307345 85/238 (36%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03201 275..279
Elo68alphaNP_729666.2 ELO 23..260 CDD:279492 85/238 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.