DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cplx1 and cpx

DIOPT Version :10

Sequence 1:NP_074055.1 Gene:Cplx1 / 64832 RGDID:70944 Length:134 Species:Rattus norvegicus
Sequence 2:NP_001262248.1 Gene:cpx / 64877 FlyBaseID:FBgn0041605 Length:157 Species:Drosophila melanogaster


Alignment Length:140 Identity:57/140 - (40%)
Similarity:74/140 - (52%) Gaps:15/140 - (10%)


- Green bases have known domain annotations that are detailed below.


  Rat     3 FVMKQALGGATKDMGKMLGGDEEKDPD----AAKKEEERQEALRQAEEERKAKYAKMEAEREVMR 63
            |:.||.:|.....:...:|||...|.|    |.::|.|||||:::||:.||.|:.|||.|||.||
  Fly     4 FIAKQMVGNQLSAVKGAVGGDGGDDGDDKEKAEEEERERQEAIKEAEDRRKEKHRKMEEEREKMR 68

  Rat    64 QGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKAIPPGCGDEPEEED------ESILDTVIK 122
            |.|||||.|||||| ..||....|.|   .|.|.||. |.....|.|:|:      :|:|.....
  Fly    69 QDIRDKYNIKKKEE-IVEAAPQEEPN---PLMRKKKT-PEELAAEAEQEELDDFTSKSLLPLSSA 128

  Rat   123 YLPGPLQDMF 132
            ..||....::
  Fly   129 VEPGSASGIY 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cplx1NP_074055.1 Synaphin 1..133 CDD:461755 57/140 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..60 25/60 (42%)
Interaction with the SNARE complex 48..70 15/21 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..114 16/45 (36%)
cpxNP_001262248.1 Synaphin 2..124 CDD:461755 54/124 (44%)

Return to query results.
Submit another query.