DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CREB3L2 and CrebB

DIOPT Version :10

Sequence 1:NP_919047.2 Gene:CREB3L2 / 64764 HGNCID:23720 Length:520 Species:Homo sapiens
Sequence 2:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster


Alignment Length:265 Identity:63/265 - (23%)
Similarity:103/265 - (38%) Gaps:68/265 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   125 IKTEPVTDEPPPGLVPSVTLT-----ITAISTPLEK----EEPPLEMNTGVDSSCQTIIPKIKLE 180
            ::.:.|....|.|::.:...|     ..|.:|.::|    .:||   |:.|          |...
  Fly    99 LQVQSVIQANPSGVIQTAAGTQQQQQALAAATAMQKVVYVAKPP---NSTV----------IHTT 150

Human   181 PHEVDQFLNFSPKEAPVDHLHLPPTPPSSHGSDSEGSLSPNPRLHPFSLPQTHSPS--------- 236
            |....|..|..|...|   ..:.|.|.:.|..||:.|||.:...|..| ..|..||         
  Fly   151 PGNAVQVRNKIPPTFP---CKIKPEPNTQHPEDSDESLSDDDSQHHRS-ELTRRPSYNKIFTEIS 211

Human   237 ------RAAPRAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLSK-----S 290
                  .:.|.:...|:|        :|.|:|............:...|.:..::..:.     :
  Fly   212 GPDMSGASLPMSDGVLNS--------QLAGTGAGGNAANSSLMQLDPTYYLSNRMSYNTNNSGIA 268

Human   291 EEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQ 355
            |::..|:..|..||:.:|:|.|||||||:..||              .:|.||||.|:.|:::|:
  Fly   269 EDQTRKREIRLQKNREAARECRRKKKEYIKCLE--------------NRVAVLENQNKALIEELK 319

Human   356 KLQTL 360
            .|:.|
  Fly   320 SLKEL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CREB3L2NP_919047.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..264 20/83 (24%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 296..325 15/28 (54%)
bZIP_CREB3 305..348 CDD:269837 16/42 (38%)
coiled coil 305..348 CDD:269837 16/42 (38%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 336..357 8/20 (40%)
S1P recognition. /evidence=ECO:0000303|PubMed:17178827 427..430
CrebBNP_001334685.1 pKID <191..>214 CDD:396650 5/23 (22%)
bZIP_CREB1 274..327 CDD:269838 25/65 (38%)
coiled coil 275..327 CDD:269838 24/64 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.