Sequence 1: | NP_003021.3 | Gene: | SHOX2 / 6474 | HGNCID: | 10854 | Length: | 355 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001014693.1 | Gene: | ey / 43812 | FlyBaseID: | FBgn0005558 | Length: | 898 | Species: | Drosophila melanogaster |
Alignment Length: | 440 | Identity: | 93/440 - (21%) |
---|---|---|---|
Similarity: | 135/440 - (30%) | Gaps: | 238/440 - (54%) |
- Green bases have known domain annotations that are detailed below.
Human 80 GGGAGGGAGGGRSPVRELDMGAAERSREPGSPRLTEGRRKPTKAEVQATLLLPGEAFRFLVSPEL 144
Human 145 KDRKEDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQ 209
Human 210 VWFQNRRAKCRKQE-------------------------------NQLH--KGVLIGAAS----- 236
Human 237 ------------------------------------------------QFEACR----------- 242
Human 243 ----------------------VAPYVNVG--------------ALRMPFQQDSHCNVTPL-SFQ 270
Human 271 --------------VQAQLQLDS-----------AVAHAHHHLHP-----------------HLA 293
Human 294 AH---APYMMFPAPPFGLPLATLAADSASAASVVAAAAAAKTTSKNSSIA 340 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
SHOX2 | NP_003021.3 | Homeobox | 167..220 | CDD:306543 | 31/52 (60%) |
OAR | 335..351 | CDD:309087 | 2/6 (33%) | ||
ey | NP_001014693.1 | PAX | 98..221 | CDD:128645 | |
Homeobox | 475..527 | CDD:278475 | 31/51 (61%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R6207 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |