DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SHH and wrt-4

DIOPT Version :9

Sequence 1:NP_000184.1 Gene:SHH / 6469 HGNCID:10848 Length:462 Species:Homo sapiens
Sequence 2:NP_510593.1 Gene:wrt-4 / 181664 WormBaseID:WBGene00006950 Length:557 Species:Caenorhabditis elegans


Alignment Length:211 Identity:58/211 - (27%)
Similarity:95/211 - (45%) Gaps:41/211 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   188 ENSVAAKSGG---------------CFPGSATVHLEQGGTKLVKDLSPGDRVLAADDQG-RLLYS 236
            :|.|.|...|               ||||.|.|::..||.|.:.:|:.||.|.|.|..| ::.:.
 Worm   321 QNPVPAAPAGYAPMGFAPSGLQLYYCFPGDAMVNVYNGGFKRMDELAVGDWVQALDKNGSQVTFI 385

Human   237 DFLTFLDRDDGAKKVFYVIE-TREPRERLLLTAAHLLFV----APHNDSATGEPEASSGSGPPSG 296
            ....:|.||  .|:|...:| |.:..|...||..||:||    .|::     |.|..:.:..|  
 Worm   386 PVQYWLHRD--PKQVADFVEFTLDNGETFSLTEKHLVFVTQCSVPYS-----EDENINANPVP-- 441

Human   297 GALGPRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLSEEAAGAYAPLTAQGTILINRVLA 361
                     |.||..|...| :|.|...:......|..:.:.:: .|.|:|:|::|.:|::|:.|
 Worm   442 ---------AERVNIGDCFY-IAHRKKSQMYQRVKVLDINIVQK-TGIYSPMTSRGHLLVDRIHA 495

Human   362 SCYAVIEEHSWAHRAF 377
            ||::..:.:|..:..|
 Worm   496 SCHSETDNYSLQNTFF 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SHHNP_000184.1 Cardin-Weintraub. /evidence=ECO:0000269|PubMed:23118222 32..38
HH_signal 39..184 CDD:279432
Hint 187..448 CDD:279426 58/211 (27%)
Hint 198..363 CDD:238035 50/170 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..302 3/22 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 395..414
wrt-4NP_510593.1 Hint 342..547 CDD:279426 54/190 (28%)
Hint 346..497 CDD:238035 50/170 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161448466
Domainoid 1 1.000 79 1.000 Domainoid score I6066
eggNOG 1 0.900 - - E1_KOG3638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.704428 Normalized mean entropy S4101
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1169356at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.700

Return to query results.
Submit another query.