DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SHBG and LpR2

DIOPT Version :9

Sequence 1:NP_001031.2 Gene:SHBG / 6462 HGNCID:10839 Length:402 Species:Homo sapiens
Sequence 2:NP_001097928.1 Gene:LpR2 / 43105 FlyBaseID:FBgn0051092 Length:1064 Species:Drosophila melanogaster


Alignment Length:246 Identity:52/246 - (21%)
Similarity:79/246 - (32%) Gaps:95/246 - (38%)


- Green bases have known domain annotations that are detailed below.


Human    25 RQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDT 89
            |.|......:.|||.:..|   :..|..:      |..|||.:.||....| .|....| ::.||
  Fly   648 RTGMIFWSDVATQSIYKAP---IDEGNDR------TVVLTKSSVTSDGLAV-DWIYNHV-YFTDT 701

Human    90 -------------------------------NPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPR 123
                                           :|.:.|.               :|:..  ||.||
  Fly   702 HKCTIELTNFEGSMGKVLVKDSLDIPRSIALDPIEGWM---------------YWSDW--GASPR 749

Human   124 LD----DGRWHQV-----EVKMEGDSVLLEVDGEEVLRLRQVSGPLT---------SKRHPIMRI 170
            ::    ||. |:.     :||.. :.:.|::..:   ||..|.|.|.         |:||.:   
  Fly   750 IERAGMDGT-HRTAIITYDVKWP-NGITLDLVQK---RLYWVDGKLNTISSSNYDGSQRHQV--- 806

Human   171 ALGGLLFPASNLRLPL-VPALDGCLRRDSWLDKQAEISASAPTSLRSCDVE 220
                 |:....||.|. :...:..:....| ||||...|:   .....|||
  Fly   807 -----LYSGEYLRHPFSITTFEDYVYWTDW-DKQAVFKAN---KFNGMDVE 848

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SHBGNP_001031.2 Laminin_G_1 75..205 CDD:278483 34/179 (19%)
LpR2NP_001097928.1 LDLa 193..224 CDD:197566
LDLa 235..267 CDD:197566
LDLa 277..313 CDD:238060
LDLa 356..388 CDD:197566
LDLa 400..432 CDD:197566
LDLa 442..476 CDD:238060
LDLa 484..517 CDD:197566
FXa_inhibition 527..562 CDD:291342
EGF_CA 564..594 CDD:214542
LY 675..715 CDD:214531 10/41 (24%)
LY 717..760 CDD:214531 9/60 (15%)
LY 763..803 CDD:214531 9/43 (21%)
FXa_inhibition 877..918 CDD:291342
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.