DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SHBG and LanA

DIOPT Version :9

Sequence 1:NP_001031.2 Gene:SHBG / 6462 HGNCID:10839 Length:402 Species:Homo sapiens
Sequence 2:NP_476617.1 Gene:LanA / 38723 FlyBaseID:FBgn0002526 Length:3712 Species:Drosophila melanogaster


Alignment Length:383 Identity:82/383 - (21%)
Similarity:137/383 - (35%) Gaps:119/383 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    76 RTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLH---NHWAQLTVGAGPRLDDGRWHQVEVKME 137
            ||..|.|::.|..:..:||:..:.|.|||...::.   ...|::|..|  .|:||.||.|||...
  Fly  3380 RTERPNGLLIYAGSKQRDDFIAVYLLDGRVTYEIRVGAQLQAKITTEA--ELNDGTWHTVEVVRT 3442

Human   138 GDSVLLEVD-----GEEVLRLRQVSGPLTSKRHPIMRIALGGL-LFPASNLR-----LPLVPALD 191
            ...|.|.:|     |...|...: |.|:.:...||.   |||: .|..|.::     ...||..:
  Fly  3443 QRKVSLLIDKLEQPGSVDLNAER-SAPVLAVELPIY---LGGVNKFLESEVKNLTDFKTEVPYFN 3503

Human   192 GCLRRDSW----LDKQAEISASAPTSLRSCDVESNPGIF-------------LPPGTQA----EF 235
            |||:...:    |:...|.....|     |..:...|:|             ...||:.    :|
  Fly  3504 GCLKNIKFDAMDLETPPEEFGVVP-----CSEQVERGLFFNNQKAFVKIFDHFDVGTEMKISFDF 3563

Human   236 NLRDIPQPHAEPWA------------------FSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQ 282
            ..||   |:...::                  |::...||....:.:.|    |.|.|:.....:
  Fly  3564 RPRD---PNGLLFSVHGKNSYAILELVDNTLYFTVKTDLKNIVSTNYKL----PNNESFCDGKTR 3621

Human   283 DQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRL 347
            :.:.:.|.         .|:.:.:.. :|.:..|.::||.:.....|                 |
  Fly  3622 NVQAIKSK---------FVINIAVDF-ISSNPGVGNEGSVITRTNRP-----------------L 3659

Human   348 FLGA------LPGEDSSTSF--CLNGLWAQGQRLDVDQALNR------SHEIWTHSCP 391
            |||.      .||..:..||  |::       :::|:|.:..      ..:||...||
  Fly  3660 FLGGHVAFQRAPGIKTKKSFKGCIS-------KVEVNQRMINITPNMVVGDIWQGYCP 3710

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SHBGNP_001031.2 Laminin_G_1 75..205 CDD:278483 42/146 (29%)
LanANP_476617.1 LamNT 18..271 CDD:214532
EGF_Lam 272..>314 CDD:238012
EGF_Lam 332..389 CDD:238012
EGF_Lam 402..443 CDD:238012
EGF_Lam 448..491 CDD:238012
Laminin_EGF 495..543 CDD:278482
Laminin_EGF 541..589 CDD:278482
Laminin_EGF 587..634 CDD:278482
EGF_Lam 631..673 CDD:238012
Laminin_EGF 677..729 CDD:278482
Laminin_EGF 732..782 CDD:278482
EGF_Lam 785..828 CDD:238012
CBM6-CBM35-CBM36_like 831..966 CDD:271143
Laminin_EGF 1375..1423 CDD:278482
EGF_Lam 1420..1457 CDD:238012
Laminin_EGF 1466..1516 CDD:278482
Laminin_EGF 1514..1562 CDD:278482
LamB 1632..1760 CDD:214597
Laminin_EGF <1775..1801 CDD:278482
EGF_Lam 1808..1851 CDD:238012
EGF_Lam 1859..1907 CDD:214543
EGF_Lam 1916..1968 CDD:238012
EGF_Lam 1969..2015 CDD:238012
EGF_Lam 2016..>2054 CDD:238012
EGF_Lam 2063..>2097 CDD:238012
Laminin_I 2129..2385 CDD:283627
Tar 2278..2662 CDD:223910
Laminin_II 2566..2700 CDD:283628
LamG 2674..2843 CDD:238058
LamG 2878..3029 CDD:238058
LamG 3078..3205 CDD:214598
LamG 3349..3512 CDD:238058 41/137 (30%)
LamG 3535..3689 CDD:238058 31/194 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.