DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BNC1 and disco

DIOPT Version :9

Sequence 1:NP_001708.3 Gene:BNC1 / 646 HGNCID:1081 Length:994 Species:Homo sapiens
Sequence 2:NP_001033847.1 Gene:disco / 32579 FlyBaseID:FBgn0000459 Length:568 Species:Drosophila melanogaster


Alignment Length:495 Identity:132/495 - (26%)
Similarity:182/495 - (36%) Gaps:106/495 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   250 NPL--PPALIGSLPEQYMLEQGHDQSQDPKQEVHGPFPDSSFLTSSSTPFQVEKDQCLNCPDAIT 312
            ||.  |..|:|..|..:             |.||      |.|.|...|         |.....:
  Fly     6 NPFMSPAYLLGHGPHSH-------------QHVH------SHLPSHPQP---------NAASPAS 42

Human   313 KKEDSTHLSDSSSYNIVTKFERTQLSPEAKVKPERNSLG------TKKGRVFCTACEKTFYDKGT 371
            ....|:.....|:....|. ..:.|.|.....|..|..|      |.|.||.|:.|.|||.|||.
  Fly    43 SPGGSSGSGSGSAAGSGTG-SGSSLKPRRWGSPPINLAGQFINPATGKKRVQCSICFKTFCDKGA 106

Human   372 LKIHYNAVHLKIKHKCTIEGCNMVFSSLRSRNRHSANPNPRLHMP-MNRNNRDKDLRN------- 428
            ||||::||||:..||||:|||||||||.||||||||||||:||.| :.|.....|.|.       
  Fly   107 LKIHFSAVHLREMHKCTVEGCNMVFSSRRSRNRHSANPNPKLHSPHIRRKISPHDGRTAQQFPVF 171

Human   429 SLNLASSENYKCPGFTVTSPDCRPPP----------------------------SYPGSGEDSKG 465
            |...|::.........|..|...|||                            ..|.||.....
  Fly   172 SPGTAAAAAAVAGRLPVAFPGLLPPPPPHHGHHPYVMFGGQAGLHGLGLLSTGCQDPDSGSVDNE 236

Human   466 QPAFPNIGQNGVLFPNLKTVQPVLPFYRSPATPAE--------VANTPGILPSLPLLSSS--IPE 520
            |.|.|. ..|..::.:::...      .|||..:|        ......:..||.|.|||  ..:
  Fly   237 QDADPE-DDNDFVYVDMQANS------SSPAASSEDQEEHERDNEQDEEMHCSLSLASSSSIAAD 294

Human   521 QLISNEMPFDALPKKKSRKSSMPIKIEKEAVEIANEKRHNLSSDEDMPLQVVSEDEQEACSPQSH 585
            :..:.:.|.| ....|.|||....:.|:|     .|:.....::::....|.|:.|.|  ..|.|
  Fly   295 EERAADQPLD-FSLHKRRKSEQDREQEQE-----QEQEREREAEKEQEQDVESDKEHE--PEQEH 351

Human   586 RVSEEQHVQSGGLGKPFPEGERPCHRESVIESSGAISQTPEQATHNSERETEQTPALIMVPREVE 650
            .:..|:...|.........|:|..|..:.  ||.|.|.....:..:|.......|....:..:::
  Fly   352 ELEREKRSPSDAFSMDQLLGKRKRHDSTA--SSSACSTAAASSASSSSASASANPPQTSIKMDLD 414

Human   651 DGGHEHYFTPGME----PQVPFSDYMELQQRLLAGGLFSA 686
            ......|.|...:    |.:...::..|  |||...:|:|
  Fly   415 PDSDSAYMTSRRQMLPLPVLDLEEHHHL--RLLQTQMFAA 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BNC1NP_001708.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Hydrophobic 240..249
C2H2 Zn finger 359..380 CDD:275368 13/20 (65%)
C2H2 Zn finger 387..405 CDD:275368 15/17 (88%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 402..425 14/23 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..472 11/55 (20%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:9223293 533..539 1/5 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 555..639 17/83 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 859..881
C2H2 Zn finger 930..951 CDD:275370
C2H2 Zn finger 958..976 CDD:275370
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 970..994
discoNP_001033847.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158835
Domainoid 1 1.000 85 1.000 Domainoid score I8179
eggNOG 1 0.900 - - E1_2C0EZ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D59377at33208
OrthoFinder 1 1.000 - - FOG0002551
OrthoInspector 1 1.000 - - mtm8668
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15021
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3798
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.