DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SH3GL2 and PIN3

DIOPT Version :10

Sequence 1:XP_011516307.1 Gene:SH3GL2 / 6456 HGNCID:10831 Length:386 Species:Homo sapiens
Sequence 2:NP_015480.1 Gene:PIN3 / 856277 SGDID:S000006358 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:100 Identity:31/100 - (31%)
Similarity:47/100 - (47%) Gaps:18/100 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   294 RMSLEFPTGDST-------QPNGGLSHTGTP-------KPSGVQMDQPCCRALYDFEPENEGELG 344
            |..|:|..|.:.       |.|..|.....|       .|:.::.    ..|||.|:|:.:|:||
Yeast    14 RTELDFLKGSNVISNDVYDQINKSLPAKWDPANAPRNASPASLEY----VEALYQFDPQQDGDLG 74

Human   345 FKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVE 379
            .|.||.:.|..::...||:|..:|.:|.||.|||:
Yeast    75 LKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVK 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SH3GL2XP_011516307.1 BAR_Endophilin_A1 59..281 CDD:153297
SH3_Endophilin_A 327..381 CDD:212737 22/52 (42%)
PIN3NP_015480.1 SH3 58..110 CDD:473055 22/55 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.