DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SGTA and CG31294

DIOPT Version :10

Sequence 1:NP_003012.1 Gene:SGTA / 6449 HGNCID:10819 Length:313 Species:Homo sapiens
Sequence 2:NP_732055.1 Gene:CG31294 / 318666 FlyBaseID:FBgn0051294 Length:225 Species:Drosophila melanogaster


Alignment Length:103 Identity:36/103 - (34%)
Similarity:54/103 - (52%) Gaps:9/103 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    84 SEEDSAEAER--------LKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGN 140
            |.:|.|||.|        .:..|||:.:..|:|.||:||.|||:....:.|.:||||.|..|..:
  Fly    91 SPKDRAEARRDREIVADSFRRLGNEEYRRTNYEKAVYFYSKAIQYVADSPVLYCNRALAKIKKRD 155

Human   141 YAGAVQDCERAIC-IDPAYSKAYGRMGLALSSLNKHVE 177
            :..|:.|.:..|. :||.:.:|:.....||:.||...|
  Fly   156 FKLALFDLDYVIFNLDPIHLRAWLYRAGALARLNNESE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SGTANP_003012.1 SGTA_dimer 5..64 CDD:465168
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..100 7/23 (30%)
Spy 85..>199 CDD:443119 35/102 (34%)
TPR 1 91..124 14/40 (35%)
TPR repeat 91..119 CDD:276809 13/35 (37%)
TPR repeat 124..154 CDD:276809 10/30 (33%)
TPR 2 125..158 12/33 (36%)
TPR 3 159..192 6/19 (32%)
TPR repeat 159..187 CDD:276809 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..269
CG31294NP_732055.1 NlpI <106..>199 CDD:443815 30/88 (34%)
TPR repeat 106..134 CDD:276809 11/27 (41%)
TPR repeat 139..170 CDD:276809 10/30 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.