DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SGSH and Sgsh

DIOPT Version :9

Sequence 1:NP_000190.1 Gene:SGSH / 6448 HGNCID:10818 Length:502 Species:Homo sapiens
Sequence 2:NP_650760.1 Gene:Sgsh / 42266 FlyBaseID:FBgn0038660 Length:524 Species:Drosophila melanogaster


Alignment Length:503 Identity:275/503 - (54%)
Similarity:338/503 - (67%) Gaps:20/503 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    11 LLLVLGLCRARPRNALLLLADDGGFESGAYNNSAIATPHLDALARRSLLFRNAFTSVSSCSPSRA 75
            |.|:.| |.|.|:|.|||||||.|||||||.|....||:|||||:|.|||.|||||||||||||:
  Fly    10 LWLIAG-CSAGPQNVLLLLADDAGFESGAYLNKFCQTPNLDALAKRGLLFNNAFTSVSSCSPSRS 73

Human    76 SLLTGLPQHQNGMYGLHQDVHHFNSFDKVRSLP-LLLSQAGVR--TGIIGKKHVGPETVYPFDFA 137
            .||||...|.:|||||||.||:||......||| |:..|:|.|  :|||||||||....:.|||.
  Fly    74 QLLTGQAGHSSGMYGLHQGVHNFNVLPDTGSLPNLIRDQSGGRILSGIIGKKHVGAANNFRFDFE 138

Human   138 YTEENGSVLQVGRNITRIKLLVRKFL-QTQDD-RPFFLYVAFHDPHRCGHSQPQYGTFCEKFGNG 200
            .|||..|:.|:||||||:|...|:|| |.:|: :||||.|.|||||||||..||:|.|||::|:|
  Fly   139 QTEEQHSINQIGRNITRMKEYARQFLKQAKDEKKPFFLMVGFHDPHRCGHITPQFGEFCERWGSG 203

Human   201 ESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGRMDQGVGLVLQELRDAGVLND 265
            |.|||.||||.|..||..::.||.::|:|...|.:|||||.|:.|:||||||:|:||..|||.:.
  Fly   204 EEGMGSIPDWKPIYYDWRNLDVPAWLPDTDVVRQELAAQYMTISRLDQGVGLMLKELEAAGVADQ 268

Human   266 TLVIFTSDNGIPFPSGRTNLYWPGTAEPLLVSSPEHPKRWGQVSEAYVSLLDLTPTILDWFSIPY 330
            ||||:|||||.|||.||||||..|...||::|||....|..:.:.|.|||||:.|:::|...||.
  Fly   269 TLVIYTSDNGPPFPGGRTNLYEHGIRSPLIISSPNKEDRHHEATAAMVSLLDIYPSVMDALQIPR 333

Human   331 PSYAIFGSKTIHLTGRSLLPALEAEPLWA---TVFGSQSHHEVTMSYPMRSVQHRHFRLVHNLNF 392
            |:       ...:.|||:||.|..||...   :||||.|:|||||:||||.|::|.::|:||:|:
  Fly   334 PN-------DTKIVGRSILPVLREEPPIKESDSVFGSHSYHEVTMAYPMRMVRNRRYKLIHNINY 391

Human   393 KMPFPIDQDFYVSPTFQDLLNRTTAGQPTGWYKDLRHYYYRARWELYDRSRDPHETQNLATDPRF 457
            ...||||||||.|||||.:||.|...|...||:.|..||.|..|||||...||.|..|||...::
  Fly   392 WADFPIDQDFYTSPTFQQILNATLRKQTLPWYRSLLQYYQRPEWELYDIKTDPLERFNLADKAKY 456

Human   458 AQLLEMLRDQLAKWQWETHDPWVCAPDGVLEE----KLSPQCQPLHNE 501
            ...|:.||:||..||..|.|||.|||..||:|    |..|.|..|.:|
  Fly   457 NGTLKQLREQLFDWQVATKDPWRCAPHAVLQEQGVYKDQPVCLTLGHE 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SGSHNP_000190.1 SGSH 24..472 CDD:293751 252/455 (55%)
SgshNP_650760.1 AslA 17..476 CDD:225661 257/465 (55%)
SGSH 22..471 CDD:293751 252/455 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150913
Domainoid 1 1.000 354 1.000 Domainoid score I997
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H167
Inparanoid 1 1.050 522 1.000 Inparanoid score I1266
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63124
OrthoDB 1 1.010 - - D194238at33208
OrthoFinder 1 1.000 - - FOG0007960
OrthoInspector 1 1.000 - - oto89500
orthoMCL 1 0.900 - - OOG6_107938
Panther 1 1.100 - - LDO PTHR43108
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5386
SonicParanoid 1 1.000 - - X5904
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.