DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SGSH and CG7402

DIOPT Version :9

Sequence 1:NP_000190.1 Gene:SGSH / 6448 HGNCID:10818 Length:502 Species:Homo sapiens
Sequence 2:NP_649023.1 Gene:CG7402 / 39994 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster


Alignment Length:575 Identity:130/575 - (22%)
Similarity:210/575 - (36%) Gaps:156/575 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    11 LLLVLGLCRARPRNALLLLADDGGFESGAYNNS-AIATPHLDALARRSLLFRNAFTSVSSCSPSR 74
            |.|..|...:...|.:::|.||.|....:::.| .|.||::||||...:|....:.. :.|:|||
  Fly    16 LSLAYGSGYSTKPNIVIILIDDMGMNDVSFHGSNQILTPNIDALAYNGILLNKHYVP-NLCTPSR 79

Human    75 ASLLTGLPQHQNGMYGLHQDVHHFNSF--------DKVRSLPLLLSQAGVRTGIIGKKHVG---- 127
            |:|||       |.|.:|..:.||...        .:.|.:|.:...||..|.::||.|:|    
  Fly    80 ATLLT-------GKYPIHTGMQHFVIITDEPWGLPQRERLMPEIFRDAGYSTHLVGKWHLGFWRK 137

Human   128 --PETVYPFDFAYTEENGSVLQVGRNITRIKLLVRKFLQTQDDRPFFLYVAFHDPHRCGHSQPQY 190
              ..|:..||..:...||.:.....   ::::|.|.:....|.|        .|...|..:...|
  Fly   138 DLTPTMRGFDHHFGYYNGYIDYYDH---QVRMLDRNYSAGLDFR--------RDLEPCPEANGTY 191

Human   191 GTFCEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNT-----------------PAARADLAA 238
            .|  |.|   .|...||.:...:: .||.:::.:...:|                 |..|.....
  Fly   192 AT--EAF---TSEAKRIIEQHDKS-KPLFMVLSHLAVHTGNEDSPMQAPEEEVAKFPHIRDPKRR 250

Human   239 QYT-TVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIP-----------FP-SGRTNLYWPGT 290
            .|. .:..:|:.|...:..|:|.|:||:::::..||||.|           :| .|:....|.|.
  Fly   251 TYAGMISSLDKSVAQTIGALKDNGMLNNSIILLYSDNGAPTIGIHSNAGSNYPYRGQKESPWEGG 315

Human   291 A-------EPLLVSSPEHPKRWGQVSEAYVSLLDLTPTILDWFSIPYPSYAIFGSKTIHLTGRSL 348
            .       .|||       |..|.||...:..:|..||:.....:..|       :.:.|.|.:|
  Fly   316 IRSAGALWSPLL-------KERGYVSNQAIHAVDWLPTLAGAAGVSLP-------QDLPLDGINL 366

Human   349 LPALEA--EPLWAT-------VFGSQSHHEVTMSYPM-RSVQHRHFRLVHNLNFKMPFPIDQDF- 402
            .|.|..  ||...|       |||..|:...|:.|.. .|.:.|:.:.:..|......|:.:.: 
  Fly   367 WPMLSGNEEPKPRTMIHVLDEVFGYSSYMRDTLKYVNGSSFKGRYDQWLGELETNEDDPLGESYE 431

Human   403 --YVSPTFQDLL-NR--------------TTAGQPTGWYKDLRHYYYRARWE------LYDRSRD 444
              .::...|.|| ||              |....|......|..::   :.|      .:|.::|
  Fly   432 QHVLASDVQSLLGNRGLTKDRIRQMRSEATETCPPIEGQNPLESHF---KCEPLKAPCFFDLAKD 493

Human   445 PHETQNLATDPRFAQLLEMLRDQL--------------------------AKWQW 473
            |.|..|||  ..:...|:.|.|:|                          ..|:|
  Fly   494 PCERYNLA--QMYPLQLQQLADELEQIRKTAIPSARVPHSDSRANPTFHNGNWEW 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SGSHNP_000190.1 SGSH 24..472 CDD:293751 125/559 (22%)
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 110/472 (23%)
4-S 28..436 CDD:293753 105/446 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.