DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SGK1 and S6k

DIOPT Version :9

Sequence 1:NP_001137148.1 Gene:SGK1 / 6446 HGNCID:10810 Length:526 Species:Homo sapiens
Sequence 2:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster


Alignment Length:387 Identity:164/387 - (42%)
Similarity:230/387 - (59%) Gaps:48/387 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   160 EPELM------------------NANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGK 206
            ||||.                  |.||.       :|.||        |.||...||:|||.:||
  Fly    41 EPELCINLHQDTEGQETIQLCEENVNPG-------KIKLG--------PKDFELKKVLGKGGYGK 90

Human   207 VLLARHKA---EEVFYAVKVLQKKAIL-KKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKL 267
            |...|..|   ...::|:|||:|.:|: .:|:..|..:|||: |:.|||||:|.|.::|||..||
  Fly    91 VFQVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNI-LEAVKHPFIVELVYAFQTDGKL 154

Human   268 YFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIV 332
            |.:|:|::|||||.||:||..|||....||.:||..|||:||.|.|:||||||||||||:|||:.
  Fly   155 YLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENILLDAQGHVK 219

Human   333 LTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNT 397
            |||||||||:|:....|.|||||.||:|||:|.:..:.:.||||.|||::::||.|:|||.:.|.
  Fly   220 LTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMFDMLTGVPPFTAENR 284

Human   398 AEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGA-KDDFMEIKSHVFFSLINWDDLINK 461
            .:..:.||...|.|...:|..||.|:..|:::...:|||: .:|...::.|.||..:||||::.:
  Fly   285 KKTIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFKHVNWDDVLAR 349

Human   462 KITPPFNPNVSGPNDLRHFDPEFTEE-PVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPPT 522
            ::.||..|.:...:|:..||..||.: ||     .|||...::.|   |...|.||:|..|:
  Fly   350 RLEPPIKPLLRSEDDVSQFDTRFTRQIPV-----DSPDDTTLSES---ANLIFQGFTYVAPS 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SGK1NP_001137148.1 S_TKc 193..450 CDD:214567 126/261 (48%)
STKc_SGK 197..519 CDD:270727 149/327 (46%)
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 149/329 (45%)
STKc_p70S6K 81..402 CDD:270736 150/329 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100157
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R469
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.