DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SGK1 and sgk-1

DIOPT Version :9

Sequence 1:NP_001137148.1 Gene:SGK1 / 6446 HGNCID:10810 Length:526 Species:Homo sapiens
Sequence 2:NP_001041299.1 Gene:sgk-1 / 181697 WormBaseID:WBGene00004789 Length:463 Species:Caenorhabditis elegans


Alignment Length:402 Identity:207/402 - (51%)
Similarity:278/402 - (69%) Gaps:20/402 - (4%)


- Green bases have known domain annotations that are detailed below.


Human   103 ANILTKPDPRTFWTNDDPAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNAN 167
            |.|.|.|..:  :...|..|.::||:.:....|.:.:|:  .:..:|:....:..|.:.|     
 Worm    62 ATIFTAPKKK--FLQADSKFYEKRRVWILVISQHLVDNN--LRSEDVRRFFHLESPDDDE----- 117

Human   168 PSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKK 232
                    ..::||||....|..:||.:|..|||||||:|...|||..:..||:|:|.|:.|.||
 Worm   118 --------NNVDLGPSERKTATANDFDYLTTIGKGSFGRVYQVRHKETKKIYAMKILSKEHIRKK 174

Human   233 KEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFY 297
            .|.||:|:|||||:.|.||||||.||||||..:|||||||::||||||.|||||:.|.|.|:|||
 Worm   175 NEVKHVMAERNVLINNFKHPFLVSLHFSFQNKEKLYFVLDHLNGGELFSHLQREKHFSESRSRFY 239

Human   298 AAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPE 362
            |||||.||||||..||:||||||||:|||.:|::||||||||||:::.:.|||||||||||||||
 Worm   240 AAEIACALGYLHEKNIIYRDLKPENLLLDDKGYLVLTDFGLCKEDMQGSKTTSTFCGTPEYLAPE 304

Human   363 VLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLL 427
            ::.|:|||:||||||||:|||||::|||||||::..||||.|:|:||:||.||:.....|:.|||
 Worm   305 IILKKPYDKTVDWWCLGSVLYEMIFGLPPFYSKDHNEMYDKIINQPLRLKHNISVPCSELITGLL 369

Human   428 QKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPV-PN 491
            ||||:||||.::||.:|:.|.||..::||.|:|:::..||.|.|....|..:...||.|..: |:
 Worm   370 QKDRSKRLGHRNDFRDIRDHPFFLPVDWDKLLNRELKAPFIPKVKNAMDTSNISKEFVEIQIDPS 434

Human   492 SIGKSPDSVLVT 503
            |:  :|..:.||
 Worm   435 SL--APQQLAVT 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SGK1NP_001137148.1 S_TKc 193..450 CDD:214567 169/256 (66%)
STKc_SGK 197..519 CDD:270727 186/308 (60%)
sgk-1NP_001041299.1 S_TKc 135..392 CDD:214567 169/256 (66%)
STKc_SGK 139..456 CDD:270727 186/308 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 370 1.000 Domainoid score I505
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H48364
Inparanoid 1 1.050 414 1.000 Inparanoid score I1159
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D196627at33208
OrthoFinder 1 1.000 - - FOG0001348
OrthoInspector 1 1.000 - - otm15346
orthoMCL 1 0.900 - - OOG6_100157
Panther 1 1.100 - - O PTHR24356
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R469
SonicParanoid 1 1.000 - - X760
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.000

Return to query results.
Submit another query.