DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DRGX and Drgx

DIOPT Version :9

Sequence 1:XP_011538391.1 Gene:DRGX / 644168 HGNCID:21536 Length:298 Species:Homo sapiens
Sequence 2:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster


Alignment Length:346 Identity:111/346 - (32%)
Similarity:136/346 - (39%) Gaps:123/346 - (35%)


- Green bases have known domain annotations that are detailed below.


Human     1 MFYFHCPPQLE-----------------GTATFGNHS--SGDFDDGFLRRKQRRNRTTFTLQQLE 46
            ||.:.|||.|.                 .|..:.::|  ....|:.|:|||||||||||||||||
  Fly     1 MFCYQCPPALHPCGPHPPRLPTLDYPFAATHPYTSYSYHPAIHDETFVRRKQRRNRTTFTLQQLE 65

Human    47 ALEAVFAQTHYPDVFTREELAMKINLTEARVQLANSCLKTELQIEINDTIIEHSEVEDHNFSLKG 111
            .||..|||||||||||||:|||||||||||||                                 
  Fly    66 ELETAFAQTHYPDVFTREDLAMKINLTEARVQ--------------------------------- 97

Human   112 ARVWFQNRRAKWRKTERGASDQ---EPG-----------AKEPMAEVTP---------PPVRNIN 153
              ||||||||||||.||...:|   |.|           ::|...::|.         ||.:..:
  Fly    98 --VWFQNRRAKWRKAERLKDEQRKRENGESSSSLDKLHDSRESSPDITGEIDDDMDDLPPRQRSH 160

Human   154 SPPPGDQARSKKEALEAQ----QSLGRTVGPAGPFFPSCLPGTLLNTATYAQALS--------HV 206
            ||....|       :|.|    .|...:..|.|        |..|:::...:.||        |.
  Fly   161 SPLANGQ-------MEQQHSHSHSHSHSRSPGG--------GMHLDSSDNERPLSSNQLTATPHS 210

Human   207 ASLKGGPLCSCCVPDPMGL----SFLPTYGCQSNRTASVATLR-----------MKAREHSEAVL 256
            ||...|.: |...|.|.|:    ...|..|......:|.:..|           |.....|....
  Fly   211 ASQSLGSI-SAGSPSPSGMHREREHTPLVGGGGQGPSSPSNSRNTDSPIEVGGPMSLTTGSRMAA 274

Human   257 QSANLLPSTSSSPGPVAKPAP 277
            .|.|   |.||:|.|....||
  Fly   275 SSNN---SASSTPTPTTPHAP 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DRGXXP_011538391.1 Homeobox 37..124 CDD:278475 47/86 (55%)
OAR 236..252 CDD:281777 3/26 (12%)
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 47/86 (55%)
OAR 428..445 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6185
eggNOG 1 0.900 - - E33208_3B9E5
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I4243
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1097815at2759
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - oto90790
orthoMCL 1 0.900 - - OOG6_108990
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5686
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.