Protein Alignment HHIP and CG3513

DIOPT Version :9

• Sequence 1: NP_071920.1
• Gene: HHIP / 64399
• HGNCID: 14866
• Length: 700
• Species: Homo sapiens
• Sequence 2: NP_608798.1
• Gene: CG3513 / 33590
• FlyBaseID: FBgn0031559
• Length: 88
• Species: Drosophila melanogaster
• Alignment Length: 115
• Identity: 22/115 - (19%)
• Similarity: 33/115 - (28%)
• Gaps: 53/115 - (46%)

Human   552 LGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQPAQTLTSECSRLCRNGY 616
            :||    :...::||.|.|....|             ..||.|:   ||:..:.
  Fly     4 IGF----VAIAFLLSLSGSRLWVH-------------AKPEMCQ---QPSSMVG----------- 37

Human   617 CTPTGKCCCS--PGWEGD--------------------FCRTAKCEPACR 644
            ....|..|.:  |.|..|                    |...::||.||:
  Fly    38 MAQDGAACMAFMPAWTYDASKNACTEFIFGGCGGNSNQFSTKSECEKACK 87

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
HHIP	NP_071920.1	Folate_rec	38..220	CDD:281076
		GSDH	226..>428	CDD:285269
		Interaction with SHH zinc binding site	376..388
CG3513	NP_608798.1	KU	29..87	CDD:238057	12/71 (17%)

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900