DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HHIP and E01G6.1

DIOPT Version :9

Sequence 1:NP_071920.1 Gene:HHIP / 64399 HGNCID:14866 Length:700 Species:Homo sapiens
Sequence 2:NP_510044.2 Gene:E01G6.1 / 181387 WormBaseID:WBGene00008449 Length:1467 Species:Caenorhabditis elegans


Alignment Length:274 Identity:64/274 - (23%)
Similarity:89/274 - (32%) Gaps:97/274 - (35%)


- Green bases have known domain annotations that are detailed below.


Human   462 SARILQIIKGKDYESEPSLLEFKPFSNGP-------LVGGFVYRGCQSERLYGSY---------- 509
            |...|.|:.....|.:|:....||....|       |.|.|..|.|.|.:::.|.          
 Worm    11 SISTLVILANAGLECDPTSNVKKPDPGSPESYLYCNLEGSFSKRKCASGKIFNSETGECDSLMQA 75

Human   510 ------VFGD----------RNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHILGFGEDE 558
                  :|..          ..|..||:..:|||        |..:..||.   .|:...|.| .
 Worm    76 DDPIDDIFSQPFFQAPDDLCGEGIPLTILSAPVT--------CNPSISSCP---DGYSCQFYE-R 128

Human   559 LGEVYILS----SSKSMTQTHN---GKLYKIVDPKRPLMPEECRATVQPAQ-TLTSECSRLCRNG 615
            .|..|...    ::||.|...|   |::..|.           .||.:|.. .||.:.|  |..|
 Worm   129 TGSSYCCQNPTPTAKSSTDKINCGEGRVTYIE-----------MATGKPRSCVLTGDNS--CPAG 180

Human   616 Y-CT----PTGKCCC---------SPGWEGDFCRTAKCEP----ACRHGGVCVRP---NKCLCKK 659
            : ||    .|.:||.         :|...|.  ...:|.|    ||::|.||.:.   ||.:|  
 Worm   181 FGCTLVAGTTTRCCAKDLGCATNSAPQLRGS--NPVECSPTDGSACKNGYVCSKSQYLNKFIC-- 241

Human   660 GYLGPQCEQVDRNI 673
                  |...|..|
 Worm   242 ------CSNPDGEI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HHIPNP_071920.1 Folate_rec 38..220 CDD:281076
GSDH 226..>428 CDD:285269
Interaction with SHH zinc binding site 376..388
E01G6.1NP_510044.2 Lustrin_cystein 95..136 CDD:291299 14/52 (27%)
WR1 289..325 CDD:214601
Kunitz_BPTI 330..386 CDD:278443
Kunitz_BPTI 437..492 CDD:278443
Kunitz_BPTI 541..596 CDD:278443
Lustrin_cystein 860..902 CDD:291299
Lustrin_cystein 909..951 CDD:291299
Lustrin_cystein 963..1006 CDD:291299
EB 1265..1321 CDD:279949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.