DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRA2B and trv

DIOPT Version :10

Sequence 1:NP_004584.1 Gene:TRA2B / 6434 HGNCID:10781 Length:288 Species:Homo sapiens
Sequence 2:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster


Alignment Length:59 Identity:17/59 - (28%)
Similarity:27/59 - (45%) Gaps:8/59 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   570 LAMNSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEKSFEERL 628
            |..|...|||.:      |.:..|::.:.|:|...:|.:|  |||..:|......|.|:
  Fly   134 LVNNGGISVRGD------ALSTAIDVDIRIMLVNYFGSVA--LTKACLPSMMARKEGRI 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRA2BNP_004584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..114
RRM_TRA2 117..196 CDD:409798
Linker 193..230
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..225
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..288
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:409789
RRM3_TIA1_like 416..489 CDD:409790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.