DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRA2B and Rbp1

DIOPT Version :10

Sequence 1:NP_004584.1 Gene:TRA2B / 6434 HGNCID:10781 Length:288 Species:Homo sapiens
Sequence 2:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster


Alignment Length:152 Identity:41/152 - (26%)
Similarity:59/152 - (38%) Gaps:49/152 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   115 DPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERA 179
            |..|.:.|..|....::.::...|:||||:.:|.:     :|...|||||.||:..||::|....
  Fly     8 DLACKVYVGNLGSSASKHEIEGAFAKYGPLRNVWV-----ARNPPGFAFVEFEDRRDAEDATRAL 67

Human   180 NGMELDGRRIRVDFSITKRPHTPTPGIYMGRPTYGSSRRRDYYDRGYDRGYDDRDYYSRSYRGGG 244
            :|....|.||||:.|                    |.|.||                    |..|
  Fly    68 DGTRCCGTRIRVEMS--------------------SGRSRD--------------------RRRG 92

Human   245 GGGGGWRAAQDRDQIYRRRSPS 266
            .||...|:...|.:|    :||
  Fly    93 EGGSSGRSGSGRYRI----TPS 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRA2BNP_004584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..114
RRM_TRA2 117..196 CDD:409798 27/78 (35%)
Linker 193..230 5/36 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..225 4/28 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..288 8/25 (32%)
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 25/73 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.