DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRA2B and CG3594

DIOPT Version :10

Sequence 1:NP_004584.1 Gene:TRA2B / 6434 HGNCID:10781 Length:288 Species:Homo sapiens
Sequence 2:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster


Alignment Length:155 Identity:41/155 - (26%)
Similarity:62/155 - (40%) Gaps:20/155 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    40 KEDSRRSRSKSRSRSESRSRSRRSSRRHYTRSRSRSRSHRRSRSRSYSRDYRRRHSHSHSPMSTR 104
            |||.|.......|:||..::|...:....: :.|.:.....:.:...:.|   :.|......|..
  Fly    51 KEDGRNPSDPEDSKSEDEAKSDDEAAAEGS-AASGAEEEESAENGQITSD---QLSSLLRGASKT 111

Human   105 RRHVGNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENV 169
            .|||           |.|..|:..||:.||...||..|.:..:.|    ..:|..|||||...::
  Fly   112 NRHV-----------LYVTNLNFETTKDDLELHFSAAGTVKSIRI----PKKRRGGFAFVEMADL 161

Human   170 DDAKEAKERANGMELDGRRIRVDFS 194
            ...:.|.:..| .||.||.|:|..|
  Fly   162 SSFQNAFQLHN-TELQGRNIKVQIS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRA2BNP_004584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..114 15/73 (21%)
RRM_TRA2 117..196 CDD:409798 26/78 (33%)
Linker 193..230 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..225
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..288
CG3594NP_523855.1 SF-CC1 36..>197 CDD:273721 41/155 (26%)
RRM 116..187 CDD:440488 26/75 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.