DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRA2B and tsu

DIOPT Version :10

Sequence 1:NP_004584.1 Gene:TRA2B / 6434 HGNCID:10781 Length:288 Species:Homo sapiens
Sequence 2:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster


Alignment Length:130 Identity:39/130 - (30%)
Similarity:62/130 - (47%) Gaps:15/130 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    78 HRRSRSRSYSRDYRRRHS-HSHSPMSTRRRHVGNRANPDPNCCLGVFGLSLYTT-------ERDL 134
            ||  :.|.:..|...|.: ||:..:   |....:...|.|.  ..|.|..|:.|       |.::
  Fly    32 HR--KGRGFGSDSNTREAIHSYERV---RNEDDDELEPGPQ--RSVEGWILFVTSIHEEAQEDEI 89

Human   135 REVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRP 199
            :|.|..||.|.::.:..|:::..|:|:|.|.:|....|..|||..||.|:.|:.|:||:...|.|
  Fly    90 QEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKGP 154

Human   200  199
              Fly   155  154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRA2BNP_004584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..114 8/36 (22%)
RRM_TRA2 117..196 CDD:409798 27/85 (32%)
Linker 193..230 2/7 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..225 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..288
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 14/54 (26%)
RRM_RBM8 67..154 CDD:409762 28/88 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.