DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRA2B and Ref2

DIOPT Version :10

Sequence 1:NP_004584.1 Gene:TRA2B / 6434 HGNCID:10781 Length:288 Species:Homo sapiens
Sequence 2:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster


Alignment Length:165 Identity:34/165 - (20%)
Similarity:68/165 - (41%) Gaps:36/165 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   122 VFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDG 186
            |..|.....:.|:.|:|::.|.:....:.||:.. .|.|.|.:.|:..::|.:..|:.:|:.|||
  Fly    79 VCNLDYGVDDDDIMELFNQDGVVEKGFVHYDRDG-NSLGTAHLSFKYREEAFQIIEQFHGVRLDG 142

Human   187 RRIRVDFSITKRPHTPTPGIYMGRPTYGSSRRRDYYDRGYDRG------YDDRDYYSRSYRGGGG 245
            ||:::......|                :.:|.|..|.....|      ..:..:.:||.:.|  
  Fly   143 RRLKLHLVQNTR----------------NFKRTDVDDLSLRMGSFKTRFLQNGTFKTRSLQNG-- 189

Human   246 GGGGWRAAQDRDQIYRRRS--PSPYYSRGGYRSRS 278
                    ..:.:::|..|  |.| :.:..::||:
  Fly   190 --------FQKSRLFRNSSFKPRP-FKKHNFKSRA 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRA2BNP_004584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..114
RRM_TRA2 117..196 CDD:409798 20/73 (27%)
Linker 193..230 5/42 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..225 4/28 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..288 7/39 (18%)
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 20/70 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.