DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRA2B and rsp-8

DIOPT Version :9

Sequence 1:NP_004584.1 Gene:TRA2B / 6434 HGNCID:10781 Length:288 Species:Homo sapiens
Sequence 2:NP_001255142.1 Gene:rsp-8 / 176613 WormBaseID:WBGene00004705 Length:309 Species:Caenorhabditis elegans


Alignment Length:256 Identity:113/256 - (44%)
Similarity:138/256 - (53%) Gaps:27/256 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    49 KSRSRSESRSRSRRSSRRHYTRSRSRSRS---HRRSRSRSYSRDYRRRH---SHSHSPMSTRRRH 107
            :|||.|.|:||||.:||   .||||.|:|   |||.|..|.||..|.|:   ..........|..
 Worm     4 RSRSNSRSQSRSRENSR---GRSRSASKSPVYHRRERESSRSRSPRARYGGGGGGGGGGGRGRNQ 65

Human   108 VGNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDA 172
            ..:|.||.|:.|||||.||.||||:|||:||.::|.|....:|||:.|..||||.|:||..::||
 Worm    66 QYDRENPQPSKCLGVFNLSSYTTEKDLRDVFGEFGEINKCDLVYDRPSGNSRGFGFIYFNLIEDA 130

Human   173 KEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGRPTYGSSRRRDYY-----DRGYDRGYDD 232
            ..|:::....:|||.:||||||:|||.|:||||.|||....|.|.....:     ||..|||...
 Worm   131 TAARDKLCNTDLDGHKIRVDFSLTKRGHSPTPGQYMGDRRGGGSSGGGRFGGGGGDRFNDRGSRG 195

Human   233 RDYYSRSYRGGGGGGGGWRAAQDRDQIY----------RRRSPSPYYSRGGYRSRSRSRSY 283
            .|.|....|||||||||.|........|          ||.||.   .|||:||......|
 Worm   196 GDRYGGDRRGGGGGGGGDRYGGGGGDRYGGDRYGGGGGRRGSPD---RRGGFRSGGGGGGY 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRA2BNP_004584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..114 28/70 (40%)
RRM_TRA2 117..196 CDD:409798 41/78 (53%)
Linker 193..230 19/41 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..225 14/33 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..288 20/52 (38%)
rsp-8NP_001255142.1 RRM_TRA2 77..154 CDD:240809 41/76 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I6299
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I3100
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524134at2759
OrthoFinder 1 1.000 - - FOG0001901
OrthoInspector 1 1.000 - - otm16110
orthoMCL 1 0.900 - - OOG6_103481
Panther 1 1.100 - - O PTHR48034
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1765
SonicParanoid 1 1.000 - - X1620
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.000

Return to query results.
Submit another query.