DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COP1 and wds

DIOPT Version :9

Sequence 1:XP_016857548.1 Gene:COP1 / 64326 HGNCID:17440 Length:775 Species:Homo sapiens
Sequence 2:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster


Alignment Length:316 Identity:82/316 - (25%)
Similarity:147/316 - (46%) Gaps:45/316 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   422 SVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVY-EYDTVIQDAVDIHYPENEM 485
            ||:|..||.:.  |...:..||:::|..:.::.|.:...|.||:: .||...:..:..|      
  Fly    57 SVKPNYTLKFT--LAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGH------ 113

Human   486 TCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASG 550
              ...||.::|||..:.|::.|| :.|:.:|:..||:..|..:.|....:..:|| ....|:.||
  Fly   114 --KLGISDVAWSSDSRLLVSGSD-DKTLKVWELSTGKSLKTLKGHSNYVFCCNFN-PQSNLIVSG 174

Human   551 SDDAKVKLWSTNLDNSVASIEAKAN-VCCVKFS------PSSRYHLAFGCADHCVHYYDLRNTKQ 608
            |.|..|::|.......:.::.|.:: |..|.|:      .||.|       |.....:|..:.:.
  Fly   175 SFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSY-------DGLCRIWDTASGQC 232

Human   609 PIMVFKGHRKAVSYAKF-VSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEK-----NFVGLA 667
            ...:.......||:.|| .:|:.|::|:.|:.||||:..|..||:::.||.|||     ||  ..
  Fly   233 LKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANF--SV 295

Human   668 SNGDYIACGSENNSLYLY----------YKGLSKTLLTFKFDTVKSVLDKDRKEDD 713
            :.|.:|..|||:|.:|::          .:|.:.|:|.......::::.....|:|
  Fly   296 TGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALEND 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COP1XP_016857548.1 RING-HC_COP1 132..177 CDD:319418
PLN00181 <240..725 CDD:177776 82/316 (26%)
WD40 repeat 491..528 CDD:293791 13/36 (36%)
WD40 repeat 535..571 CDD:293791 9/35 (26%)
WD40 repeat 576..614 CDD:293791 8/43 (19%)
WD40 repeat 620..659 CDD:293791 17/39 (44%)
WD40 repeat 663..685 CDD:293791 8/21 (38%)
wdsNP_001245503.1 WD40 64..358 CDD:238121 78/309 (25%)
WD40 repeat 75..112 CDD:293791 9/36 (25%)
WD40 repeat 118..154 CDD:293791 12/36 (33%)
WD40 repeat 159..195 CDD:293791 9/36 (25%)
WD40 repeat 202..237 CDD:293791 7/41 (17%)
WD40 repeat 244..280 CDD:293791 15/35 (43%)
WD40 repeat 288..325 CDD:293791 9/38 (24%)
WD40 repeat 331..357 CDD:293791 3/21 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.