DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX17 and tHMG2

DIOPT Version :10

Sequence 1:NP_071899.1 Gene:SOX17 / 64321 HGNCID:18122 Length:414 Species:Homo sapiens
Sequence 2:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster


Alignment Length:66 Identity:19/66 - (28%)
Similarity:36/66 - (54%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    66 SRIRRPMNAFMVWAKDE-RKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQHM 129
            :|.::||:|||:|.... ||.:..::||....|:|...|:.|:|:....|..:.|.|.:...::.
  Fly     7 ARPKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYK 71

Human   130 Q 130
            :
  Fly    72 E 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX17NP_071899.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..66 19/66 (29%)
HMG-box_SoxF_SOX17 62..142 CDD:438850 19/66 (29%)
Sox17_18_mid 203..253 CDD:463454
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..286
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..352
9aaTAD. /evidence=ECO:0000269|PubMed:34342803 361..369
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 18/62 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.