DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX17 and Dsp1

DIOPT Version :10

Sequence 1:NP_071899.1 Gene:SOX17 / 64321 HGNCID:18122 Length:414 Species:Homo sapiens
Sequence 2:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster


Alignment Length:118 Identity:25/118 - (21%)
Similarity:43/118 - (36%) Gaps:43/118 - (36%)


- Green bases have known domain annotations that are detailed below.


Human   233 SEQLHKTGFPTIHALILLEGTMNLTGEMQPLVEQLMMVKRMQHIPTPLFVLEIWKACFVGL-IES 296
            |||..:.        .|.:.|:||..:.:.|...    |:     ||.::.|      ||| .::
  Fly     2 SEQTERA--------FLKQPTVNLNNKARILAGS----KK-----TPRYIRE------VGLGFKA 43

Human   297 P----EGT---QELKWTAFTYL------------KIPQVLVKLKKYFHGDKDF 330
            |    |||   ::..|.....:            |:.:.:|..:.|.|..|.:
  Fly    44 PRDAVEGTYIDKKCPWAGNVPIRGMILTGVVLKNKMTRTIVVRRDYLHYIKKY 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX17NP_071899.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..66
HMG-box_SoxF_SOX17 62..142 CDD:438850
Sox17_18_mid 203..253 CDD:463454 4/19 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..286 6/29 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..352 6/38 (16%)
9aaTAD. /evidence=ECO:0000269|PubMed:34342803 361..369
Dsp1NP_001138203.1 HMG-box_HMGB_rpt1 182..250 CDD:438794
HMG-box_NHP6-like 262..342 CDD:438792
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.