DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRSF7 and PAB1

DIOPT Version :9

Sequence 1:NP_001026854.1 Gene:SRSF7 / 6432 HGNCID:10789 Length:238 Species:Homo sapiens
Sequence 2:NP_011092.1 Gene:PAB1 / 856912 SGDID:S000000967 Length:577 Species:Saccharomyces cerevisiae


Alignment Length:92 Identity:26/92 - (28%)
Similarity:42/92 - (45%) Gaps:9/92 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     6 RYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARN----PPGFAFVEFEDPRDAEDAVRG 66
            |..|...:::.||........|...||.:|.:.:..||.:    ..||.||.||:...|::|:..
Yeast   121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDA 185

Human    67 LDGKVICGSRVRVELSTGMPRRSRFDR 93
            |:|.::.|..:.|     .|..||.:|
Yeast   186 LNGMLLNGQEIYV-----APHLSRKER 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRSF7NP_001026854.1 RRM_SRSF7 12..88 CDD:410050 21/79 (27%)
Sufficient for interaction with NXF1 81..98 4/13 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..238
6 X 8 AA repeats of R-R-S-R-S-X-S-X 153..226
PAB1NP_011092.1 PABP-1234 38..559 CDD:130689 26/92 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.