DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRSF7 and CBC2

DIOPT Version :9

Sequence 1:NP_001026854.1 Gene:SRSF7 / 6432 HGNCID:10789 Length:238 Species:Homo sapiens
Sequence 2:NP_015147.1 Gene:CBC2 / 855925 SGDID:S000006099 Length:208 Species:Saccharomyces cerevisiae


Alignment Length:150 Identity:29/150 - (19%)
Similarity:57/150 - (38%) Gaps:42/150 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    13 VYVGNLGTGAGKGELERAFSYYGPLRTVWIARN-----PPGFAFVEFEDPRDAEDAVRGLDGKVI 72
            :|||||.....:.::...||..|.::.:.:..:     |.||.|:.:..|.:|.:|::.|....:
Yeast    48 IYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSCPDEALNALKYLSDTKL 112

Human    73 CGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKG-------HYAYDCHR--------- 121
            ....:.::|..|.....:|.|                |:.|       .:.:|..|         
Yeast   113 DEKTITIDLDPGFEDGRQFGR----------------GKSGGQVSDELRFDFDASRGGFAIPFAE 161

Human   122 -----YSRRRRSRSRSRSHS 136
                 :||...|.|:|.:::
Yeast   162 RVGVPHSRFDNSSSQSNTNN 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRSF7NP_001026854.1 RRM_SRSF7 12..88 CDD:410050 18/79 (23%)
Sufficient for interaction with NXF1 81..98 4/16 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..238 5/13 (38%)
6 X 8 AA repeats of R-R-S-R-S-X-S-X 153..226
CBC2NP_015147.1 RRM <1..>159 CDD:223796 24/126 (19%)
RRM_NCBP2 48..125 CDD:409686 17/76 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.