DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRSF7 and IST3

DIOPT Version :9

Sequence 1:NP_001026854.1 Gene:SRSF7 / 6432 HGNCID:10789 Length:238 Species:Homo sapiens
Sequence 2:NP_012270.1 Gene:IST3 / 854821 SGDID:S000001444 Length:148 Species:Saccharomyces cerevisiae


Alignment Length:93 Identity:28/93 - (30%)
Similarity:48/93 - (51%) Gaps:5/93 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     2 SRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARN-----PPGFAFVEFEDPRDAE 61
            |.:..|.....:|:|||.....:|::...||.||....|.::|:     ..|||::::||.|...
Yeast    22 SWHNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTI 86

Human    62 DAVRGLDGKVICGSRVRVELSTGMPRRS 89
            .||..|:|..|.|..::::.:...|:||
Yeast    87 LAVDNLNGFKIGGRALKIDHTFYRPKRS 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRSF7NP_001026854.1 RRM_SRSF7 12..88 CDD:410050 24/80 (30%)
Sufficient for interaction with NXF1 81..98 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..238
6 X 8 AA repeats of R-R-S-R-S-X-S-X 153..226
IST3NP_012270.1 RRM_ist3_like 22..109 CDD:409845 25/86 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.