DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRSF7 and B52

DIOPT Version :9

Sequence 1:NP_001026854.1 Gene:SRSF7 / 6432 HGNCID:10789 Length:238 Species:Homo sapiens
Sequence 2:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster


Alignment Length:350 Identity:120/350 - (34%)
Similarity:146/350 - (41%) Gaps:129/350 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    11 TKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGS 75
            ::||||.|..|..:.:|||.|..||..|.:.|..   |:.||||||.|||:|||..|:||.:.|.
  Fly     4 SRVYVGGLPYGVRERDLERFFKGYGRTRDILIKN---GYGFVEFEDYRDADDAVYELNGKELLGE 65

Human    76 RVRVELSTGMPRRSRFDR------------------------------PPARRPF---------- 100
            ||.||.:.|..|.|..||                              ||.|..:          
  Fly    66 RVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSR 130

Human   101 ----DPNDRCYECGEKGHYAYDCHRY--------------------------------------- 122
                |..|...:.||. .|| |.|:.                                       
  Fly   131 VSWQDLKDYMRQAGEV-TYA-DAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVEDRR 193

Human   123 --------------SRRRRSRSRSRSHSRSRGRR------YSRSRSRSRGRRSRSASPRRSRSIS 167
                          ||...|||||||..|||.||      .|||||:|||.||:|.||.:|||.|
  Fly   194 GGRSGGGGGSGRGRSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRS 258

Human   168 ---------LRRSRSASLRRSRSGSIKGSRYFQSPSR------SRSRSRSISRPRSSRSKSRSPS 217
                     :.:|:|.|..|:||.|.|..|..:|.||      |||||||.|..|.|||:.||.|
  Fly   259 RSRSNKSRDVSKSKSKSHSRTRSRSPKRERDSRSRSRSVSKRESRSRSRSKSIHRDSRSRDRSAS 323

Human   218 PK-----RSRSPSGSPRR-SASPER 236
            .:     ||||.|.||:. :|||:|
  Fly   324 AENKSRSRSRSRSASPKNGNASPDR 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRSF7NP_001026854.1 RRM_SRSF7 12..88 CDD:410050 36/75 (48%)
Sufficient for interaction with NXF1 81..98 7/46 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..238 68/140 (49%)
6 X 8 AA repeats of R-R-S-R-S-X-S-X 153..226 40/92 (43%)
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 35/71 (49%)
RRM2_SRSF4_like 120..191 CDD:241044 8/72 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.