DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRSF7 and lark

DIOPT Version :10

Sequence 1:NP_001026854.1 Gene:SRSF7 / 6432 HGNCID:10789 Length:238 Species:Homo sapiens
Sequence 2:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster


Alignment Length:270 Identity:79/270 - (29%)
Similarity:107/270 - (39%) Gaps:65/270 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    11 TKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGS 75
            ||::||||.......|:...|..||.:....|.||   :.||..:...|.:||::.|:|:|:.|.
  Fly    86 TKIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRN---YGFVHLDCVGDVQDAIKELNGRVVDGQ 147

Human    76 RVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHR-YSRRRRSRSRSRSHSRS- 138
            .::|::||...|       |.....|| ::||.||..||::.:|.| |......|......|.. 
  Fly   148 PLKVQVSTSRVR-------PKPGMGDP-EQCYRCGRSGHWSKECPRLYGSAGGGREPPSPLSAGG 204

Human   139 -RGRRYSRS------------RSR-SRGRRSRSASPRR---SRSISLRRSRSASLRRSRSGSIKG 186
             |.|.|.|.            |.| ..|.|......||   ||.:..||.:::.:|.        
  Fly   205 YRDRMYGRDPYPPPPPPPPFLRDRIMDGFRDYDYYDRRFEDSRDLYERRYQTSRMRD-------- 261

Human   187 SRYFQSPSRSRS-------------RSRSISRPRSSRSKSRSPSPKRS---RSPSGSP------- 228
               |..|..||.             ||.|:||...:....|||.|.||   .|..|||       
  Fly   262 ---FPPPPISRREPMPLPPTLSGSLRSCSVSRGYDTMFSRRSPPPPRSSNGMSRYGSPTPHGYED 323

Human   229 -RRSASPERM 237
             .|.|..|||
  Fly   324 FSRDAFDERM 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRSF7NP_001026854.1 RRM_SRSF7 12..88 CDD:410050 24/75 (32%)
Sufficient for interaction with NXF1 81..98 4/16 (25%)
zf-CCHC 104..119 CDD:395050 6/14 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..238 41/157 (26%)
6 X 8 AA repeats of R-R-S-R-S-X-S-X 153..226 24/91 (26%)
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 21/67 (31%)
hnRNP-R-Q <88..>258 CDD:273732 52/180 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.