DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRSF7 and nito

DIOPT Version :9

Sequence 1:NP_001026854.1 Gene:SRSF7 / 6432 HGNCID:10789 Length:238 Species:Homo sapiens
Sequence 2:NP_001286174.1 Gene:nito / 35756 FlyBaseID:FBgn0027548 Length:793 Species:Drosophila melanogaster


Alignment Length:260 Identity:72/260 - (27%)
Similarity:104/260 - (40%) Gaps:64/260 - (24%)


- Green bases have known domain annotations that are detailed below.


Human     4 YGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLD 68
            ||:....|::::|.||......:|||.|..:|.::.:...:..| :|::::|....|..||:.:.
  Fly   388 YGKVTPATRMWIGGLGAWTSVTQLEREFDRFGAIKKIEYQKGEP-YAYIQYETVEAATAAVKEMR 451

Human    69 GKVICGSRVRV-----ELSTGMPRRS-RFDRPP-------ARRP-FDPNDRCYECGEKGHYAYDC 119
            |..:.|...|:     ||....|... :..:||       .||| :||   .||  |...||   
  Fly   452 GFPLGGPERRLRTDFAELPGATPAAPFKSSKPPYDESALEYRRPEYDP---YYE--ESAAYA--- 508

Human   120 HRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSRSGSI 184
               .|...|....|...|.||      ..|.|||             .:....:...|....||:
  Fly   509 ---PRGGYSPYPPRGGYRGRG------GYRGRGR-------------GMYHYHNDVHRPPHPGSL 551

Human   185 KGS------------RYFQSPSRSRSR-SRSISR-PRSSRSKSRSPSPKRSRSPSG----SPRRS 231
            .||            .:.:.|..|..| :||.|| |...||:||||. ||:|||..    |.||:
  Fly   552 AGSSSSVPPPGGVEDEWRRPPGESYDRGARSSSREPGVERSRSRSPL-KRARSPGSDSDTSTRRN 615

Human   232  231
              Fly   616  615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRSF7NP_001026854.1 RRM_SRSF7 12..88 CDD:410050 20/80 (25%)
Sufficient for interaction with NXF1 81..98 4/24 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..238 37/127 (29%)
6 X 8 AA repeats of R-R-S-R-S-X-S-X 153..226 25/86 (29%)
nitoNP_001286174.1 RRM <56..>223 CDD:223796
RRM1_Spen 98..175 CDD:240754
RRM2_Spen 312..390 CDD:240755 1/1 (100%)
RRM3_Spen 397..467 CDD:240756 17/70 (24%)
SPOC 630..789 CDD:311609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.