DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRSF6 and Rox8

DIOPT Version :9

Sequence 1:NP_006266.2 Gene:SRSF6 / 6431 HGNCID:10788 Length:344 Species:Homo sapiens
Sequence 2:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster


Alignment Length:202 Identity:40/202 - (19%)
Similarity:77/202 - (38%) Gaps:38/202 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     4 VYIGRLSYNVREKDIQRFFSGYGRLLEVDL--------KNGYGFVEFEDSRDADDAVYELNGKEL 60
            :::|.||..:..:.::..|:.:|.:....:        ..||.||.|....:|::|:..:||:.:
  Fly    97 IFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWI 161

Human    61 CGERVI-----VEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKY---------GPPVRTEY- 110
             |.|.|     ......||....|...|...|||..:.....|..::         .|...|.| 
  Fly   162 -GSRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYC 225

Human   111 -----RLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTE 170
                 .:|.::|..       |.|: |.|.:......|:: ....|:|.:......|::....:|
  Fly   226 GGFPPNVISDDLMH-------KHFV-QFGPIQDVRVFKDK-GFSFIKFVTKEAAAHAIEHTHNSE 281

Human   171 INGRNIR 177
            ::|..::
  Fly   282 VHGNLVK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRSF6NP_006266.2 RRM1_SRSF6 1..72 CDD:410009 17/80 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..103 6/36 (17%)
RRM2_SRSF6 110..182 CDD:410159 13/74 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..344 0/2 (0%)
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 37/186 (20%)
RRM1_TIA1_like 9..80 CDD:240798
RRM2_TIA1_like 96..170 CDD:240799 17/73 (23%)
RRM3_TIA1_like 221..294 CDD:240800 14/77 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.