DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRSF6 and x16

DIOPT Version :9

Sequence 1:NP_006266.2 Gene:SRSF6 / 6431 HGNCID:10788 Length:344 Species:Homo sapiens
Sequence 2:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster


Alignment Length:351 Identity:106/351 - (30%)
Similarity:139/351 - (39%) Gaps:110/351 - (31%)


- Green bases have known domain annotations that are detailed below.


Human     3 RVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKN---GYGFVEFEDSRDADDAVYELNGKELCGER 64
            :||:|.|..|.|:.|::..|..||.|..|.:..   |:.|||||.:|||.|||..|:|:.:||.|
  Fly     9 KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTVCGRR 73

Human    65 VIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKDF 129
            ..||.:.|......|   |...||||.......|||:.|                          
  Fly    74 ARVELSTGK
YARSGG---GGGGGGGGGGGGGLGGRDRGG-------------------------- 109

Human   130 MRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYSGS 194
               .|                          |..||.  .|..||                  |.
  Fly   110 ---GG--------------------------RGDDKC--YECGGR------------------GH 125

Human   195 RSRSRSRRRSRSRSRRSSRSRSRSISKSRSRSRSRSKGRSRSRSKGRKSRSKSKSKPKSDRGSHS 259
            .:|....|::|.|.|.:|.|||||.|: |.|:||:|..||||||.|...|...:|..:.:.|   
  Fly   126 FARHCRERKARQRRRSNSFSRSRSTSR-RRRTRSKSGTRSRSRSAGSVGRRSGRSNGRDENG--- 186

Human   260 HSRSRSKDEYEKSRSRSRSRSP------KENGKGDIKSKSRSRSQSRSNSPLPVPPSKARSVSPP 318
             |.||..| :|::.|.:....|      ::.....::...||||:|||.||      ..|..|||
  Fly   187 -SASRYSD-HERNGSGAVDSPPPPKRRYEDEDDDRVRGSPRSRSRSRSASP------AVRRGSPP 243

Human   319 PKRATSRSRSRSRSKSRSRSRSSSRD 344
            .:|..|           |.|||.|||
  Fly   244 RRRGDS-----------SASRSVSRD 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRSF6NP_006266.2 RRM1_SRSF6 1..72 CDD:410009 31/71 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..103 9/27 (33%)
RRM2_SRSF6 110..182 CDD:410159 7/71 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..344 55/173 (32%)
x16NP_723226.1 RRM <1..>82 CDD:223796 31/72 (43%)
RRM_SRSF3_like 9..81 CDD:240819 31/71 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.