DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRSF6 and ssx

DIOPT Version :9

Sequence 1:NP_006266.2 Gene:SRSF6 / 6431 HGNCID:10788 Length:344 Species:Homo sapiens
Sequence 2:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster


Alignment Length:193 Identity:43/193 - (22%)
Similarity:79/193 - (40%) Gaps:47/193 - (24%)


- Green bases have known domain annotations that are detailed below.


Human     6 IGRLSYNVREKDIQRFFSGYGRL----LEVDLKN----GYGFVEFEDSRDADDAVYELNGKELCG 62
            |..|..::.::::...|||.|.:    :..|.|.    |||||:::...|::||:.:|||..:..
  Fly    97 INYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYVRN 161

Human    63 ERVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLK 127
            :|:.|.:||                .||.|.:.|:              |.|.|||...:...|.
  Fly   162 KRLKVSYAR----------------PGG
QSIKDTN--------------LYVINLSRNINDDMLD 196

Human   128 DFMRQAGEVTYADAHKERTN---EGV--IEFRSYSDMKRALDKLDGTEINGRN----IRLIED 181
            ......|.:...:..:::..   .||  :.:....:.:.|:..|:.|...|.:    :||.|:
  Fly   197 RIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRSF6NP_006266.2 RRM1_SRSF6 1..72 CDD:410009 22/73 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..103 4/27 (15%)
RRM2_SRSF6 110..182 CDD:410159 16/81 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..344 3/6 (50%)
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 23/91 (25%)
RRM_SF 179..257 CDD:302621 15/91 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.