DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stk32b and S6k

DIOPT Version :9

Sequence 1:NP_071861.1 Gene:Stk32b / 64293 MGIID:1927552 Length:414 Species:Mus musculus
Sequence 2:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster


Alignment Length:289 Identity:93/289 - (32%)
Similarity:151/289 - (52%) Gaps:17/289 - (5%)


- Green bases have known domain annotations that are detailed below.


Mouse    23 FQILRAIGKGSFGKVCIVQK---RDTKKMYAMKYMNKQKCV-ERDEVRNVFRELQIMQGLEHPFL 83
            |::.:.:|||.:|||..|:|   ||..|.:|||.:.|...| .:.:..:...|..|::.::|||:
  Fly    77 FELKKVLGKGGYGKVFQVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPFI 141

Mouse    84 VNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFTEGTVKLYICELALALEYLQRYHIIHRDIK 148
            |.|.|:||.:..::::::.|.||:|..||::...|.|.|...|:.|:.|||.:|.:..||:||:|
  Fly   142 VELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLK 206

Mouse   149 PDNILLDEHGHVHITDFNIATV-LKGSEKASSMAGTKPYMAPEVFQVYVDGGPGYSYPVDWWSLG 212
            |:|||||..|||.:|||.:... ::......:..||..|||||:..     ..|:...|||||||
  Fly   207 PENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILT-----RSGHGKAVDWWSLG 266

Mouse   213 VTAYELLRGWRPYEIHSATPIDEILNMFKVERVHYSSTWCEGMVSLLKKLLTKDPESRLSS---- 273
            ...:::|.|..|:...:.....|.:...|:....|.:....   .|:::|:.:....||.|    
  Fly   267 ALMFDMLTGVPPFTAENRKKTIETILKAKLNLPAYLTPEAR---DLVRRLMKRQEPQRLGSGPED 328

Mouse   274 LRDIQSMTYLADMNWDAVFEKALMPGFVP 302
            ...:|...:...:|||.|..:.|.|...|
  Fly   329 AAAVQIHPFFKHVNWDDVLARRLEPPIKP 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stk32bNP_071861.1 STKc_Yank1 22..283 CDD:270730 86/268 (32%)
S_TKc 23..272 CDD:214567 83/253 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..400
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 93/289 (32%)
STKc_p70S6K 81..402 CDD:270736 92/285 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.