DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RHBDF1 and ru

DIOPT Version :10

Sequence 1:XP_047290434.1 Gene:RHBDF1 / 64285 HGNCID:20561 Length:932 Species:Homo sapiens
Sequence 2:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster


Alignment Length:167 Identity:43/167 - (25%)
Similarity:72/167 - (43%) Gaps:31/167 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   727 PDQFYRLWLSL---FLHAGILHCLVSICFQMTVLRDLEKLAGWHRIAIIYLLSGVTGNLA----- 783
            |||..:||..|   .|||..||...::..|:.....||.:.|..|..:||:...:.|:|.     
  Fly   129 PDQRLQLWRFLSYALLHASWLHLGYNVLTQLLFGVPLELVHGSLRTGVIYMAGVLAGSLGTSVVD 193

Human   784 SAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLFT---FGLL---- 841
            |.:||     ||.:|..:.:||.....|..::   .:......:|:||:||:|.   :.|.    
  Fly   194 SEVFL-----VGASGGVYALLAAQLASLLLNF---GQMRHGVIQLMAVILFVFCDLGYALYSREL 250

Human   842 --------PWIDNFAHISGFISGLFLSFAFLPYISFG 870
                    |.:...||::|.::|:.:....|..:..|
  Fly   251 AMHQLQTRPSVSYIAHMTGALAGISVGLLLLRQLDGG 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RHBDF1XP_047290434.1 Rhomboid_SP 168..362 CDD:463639
Rhomboid 724..867 CDD:426384 42/162 (26%)
ruNP_524790.1 Rhomboid 129..283 CDD:426384 42/161 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.