DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB17 and rab5c

DIOPT Version :9

Sequence 1:XP_016860182.1 Gene:RAB17 / 64284 HGNCID:16523 Length:338 Species:Homo sapiens
Sequence 2:NP_958909.1 Gene:rab5c / 386807 ZFINID:ZDB-GENE-031118-30 Length:221 Species:Danio rerio


Alignment Length:137 Identity:68/137 - (49%)
Similarity:96/137 - (70%) Gaps:4/137 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    12 AAPSQPRV--FKLVLLGSGSVGKSSLALRYVKNDFKSIL-PTVGCAFFTKVVDVGATSLKLEIWD 73
            |||...::  |||||||..:||||||.||:||..|.... .|:|.||.|:.:.:..|::|.||||
Zfish    13 AAPVGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTLCLDDTTVKFEIWD 77

Human    74 TAGQEKYHSVCHLYFRGANAALLVYDITRKDSFLKAQQWLKDLEEELHPGEVLVMLVGNKTDLSQ 138
            |||||:|||:..:|:|||.||::|||||..|:|.:|:.|:|:|:.:..| .:::.|.|||.||:.
Zfish    78 TAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFTRAKNWVKELQRQASP-NIVIALAGNKADLAN 141

Human   139 EREVTFQ 145
            :|.|.||
Zfish   142 KRAVDFQ 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB17XP_016860182.1 None
rab5cNP_958909.1 Rab5_related 22..184 CDD:206653 65/128 (51%)
Ras 24..185 CDD:278499 64/126 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.