DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB17 and rab-5

DIOPT Version :9

Sequence 1:XP_016860182.1 Gene:RAB17 / 64284 HGNCID:16523 Length:338 Species:Homo sapiens
Sequence 2:NP_492481.1 Gene:rab-5 / 172755 WormBaseID:WBGene00004268 Length:208 Species:Caenorhabditis elegans


Alignment Length:140 Identity:66/140 - (47%)
Similarity:97/140 - (69%) Gaps:3/140 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     7 TPQPRAAPSQPRVFKLVLLGSGSVGKSSLALRYVKNDFKSIL-PTVGCAFFTKVVDVGATSLKLE 70
            |.:| ..|::...|||||||..:||||||.||:||..|.... .|:|.||.|:.|.:...::|.|
 Worm     8 TARP-GGPNRTCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDATIKFE 71

Human    71 IWDTAGQEKYHSVCHLYFRGANAALLVYDITRKDSFLKAQQWLKDLEEELHPGEVLVMLVGNKTD 135
            ||||||||:|||:..:|:|||.||::|||||.::||.||:.|:|:|:.:..| .:::.|.|||.|
 Worm    72 IWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQESFQKAKNWVKELQRQASP-NIVMALAGNKAD 135

Human   136 LSQEREVTFQ 145
            ::.:|.|.::
 Worm   136 VANKRTVEYE 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB17XP_016860182.1 None
rab-5NP_492481.1 Rab5_related 19..181 CDD:206653 63/128 (49%)
Ras 21..181 CDD:278499 62/126 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.