DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atp1b3b and CG33310

DIOPT Version :9

Sequence 1:NP_571745.1 Gene:atp1b3b / 64272 ZFINID:ZDB-GENE-001127-1 Length:275 Species:Danio rerio
Sequence 2:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster


Alignment Length:321 Identity:65/321 - (20%)
Similarity:117/321 - (36%) Gaps:111/321 - (34%)


- Green bases have known domain annotations that are detailed below.


Zfish    12 QSSWKDFIYNPRTGEFIGRTASSWALIFLFYLVFYGFLAGMFTLTMWVMLQTLDDHTPKY-RDRV 75
            ::.|:...:|...|::..|..|.| |..|.:.|.|.....:|::..:..::  ||.:.|. ..::
  Fly   581 RTEWRRLFFNKIHGKYKLRRPSHW-LYTLVFSVLYILFVIIFSMAWFDFIK--DDASRKVPMIKM 642

Zfish    76 ANPGLM---IRPRS--LDIAFN-RSIPQQYSKYVQHLEAFLQSYNDSLQEANEPCQEGMYFEQDD 134
            |.|.:.   |.||:  ..::|: |:..:...||. .:.|.|:.|.|   ..:.|           
  Fly   643 AQPFISFTPIGPRTNPKAVSFDPRNSTEVMEKYA-GIMALLEKYGD---YGHNP----------- 692

Zfish   135 VEEKKVCQFKRSQLRQCSGLSDTTFGYSEGNPCIIVKMNRVIGLKPRGDPH-------------- 185
                        :...|:  ::..|||..|.||:.:|:||:||.|.  :|:              
  Fly   693 ------------RFGTCT--ANEKFGYPSGEPCVFLKVNRIIGFKT--EPYINSDELVKAKIDEV 741

Zfish   186 -----------------------IACTVKGDGTLQMQLYPD-------------------EGKID 208
                                   |.|....|..:.::.:|:                   |||  
  Fly   742 EFTALKRLLENTTTEEGHLNRTWITCRSDKDKNVLIEFHPEPAIRTEYTDIEEKIEYIANEGK-- 804

Zfish   209 KSFFPYYGKILHKNYVQPLVAVKLMLGENDYNIEHTVECKVEGSDLLNNDERDKFLGRVTF 269
            ||||       ..|.|..:||:|:...:.:..:.  :.||:...   |...|.:..|:|:|
  Fly   805 KSFF-------GPNDVNRIVALKIKNLKANERVH--INCKMWAQ---NIHHRKEGYGQVSF 853

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atp1b3bNP_571745.1 Na_K-ATPase 10..268 CDD:278704 63/318 (20%)
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 33/159 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596817
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.