DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRSF2 and SC35

DIOPT Version :9

Sequence 1:NP_001182356.1 Gene:SRSF2 / 6427 HGNCID:10783 Length:221 Species:Homo sapiens
Sequence 2:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster


Alignment Length:189 Identity:116/189 - (61%)
Similarity:134/189 - (70%) Gaps:13/189 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     5 RPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAE 69
            ||||.::||.|||||||||||:|:.||||||:.|.|||:||||||||:||||||||||:||||||
  Fly    14 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAE 78

Human    70 DAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRYGGGGYGRRSRSPRRRRRSRSRSRS 134
            ||::||||.:||||||||||||||||.....|..|   ||.||||.|   ...|||.||||..|.
  Fly    79 DALEAMDGRMLDGRELRVQMARYGRPSSPTRSSSG---RRGGGGGGG---SGGRRRSRSRSPMRR 137

Human   135 RSRSRSRSRYSRSKSRSRTRSRSRSTSKSRSARRSKSK------SSSVSRSRSRSRSRS 187
            ||||..|..||||:|.. :.|..|.:..|||..|..|:      |..::.:.|||||||
  Fly   138 RSRSPRRRSYSRSRSPG-SHSPERRSKFSRSPVRGDSRNGIGSGSGGLAPAASRSRSRS 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRSF2NP_001182356.1 RRM_SRSF2_SRSF8 16..88 CDD:409751 58/71 (82%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..221 46/102 (45%)
SC35NP_001188794.1 RRM <24..>100 CDD:223796 62/75 (83%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 58/71 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152426
Domainoid 1 1.000 125 1.000 Domainoid score I5505
eggNOG 1 0.900 - - E1_KOG4207
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I3715
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51897
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003650
OrthoInspector 1 1.000 - - otm40641
orthoMCL 1 0.900 - - OOG6_104633
Panther 1 1.100 - - LDO PTHR23147
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1169
SonicParanoid 1 1.000 - - X3014
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.